1 2 3 4 5 6 7 8 9 10

Sort by : ReleasedNameDownloadsAddedRatingRelevance
TipCam

Freeware by UTIPU INC
383 x 5550Kb downloads

...video via uTIPu.com service. Features include: - Smart Zoom and Pan window can be fixed or follow...your mouse cursor - Adjustable zooming window during recording. - Free style hand drawing...Record to AVI for editing with 3rd party tools - New! Mult-language Support...
 
youtubeflash videoscreen capturescreen recordfree hostingscreencast
Portal IT Toolbar

Freeware by Portal IT
44 x 248Kb downloads

...Highlight Search Terms - Latest IT News - Zoom in, Zoom out - Web Search (powered by...Google) - System Tools (clear cache, clear cookies, clear history, clear auto...
 
toolbargameslaunchbardesktopfreewarenewssharewareprogramquicklaunchsoftwaredownloads
Picture Viewer .EXE

Shareware by SoftTech InterCorp
52 x 2377Kb downloads

...thumbnails, organize files, change wallpaper, convert, rotate, resize, zoom and print images. With support for over 20...PictureViewer .EXE provides access to powerful image management tools that make it an unparalleled resource for your...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper

Freeware by t@b
116 x 2625Kb downloads

...t@b ZS4 is advanced multi-track video editing and compositing software with more than 150 built-in video effects including excellent color and chroma keying tools, distortion effects, color...
 
bluescreeneditingmulti-trackgreen screenmulti trackzwei-steindistortion effectszoomeditorvideo compositinggreenscreenchroma keyblue screenpanzs4freecompositordistort video
Gogo Explorer

Freeware by Gogosoft
16 x 1749Kb downloads

...web page as picture 22. Domain completion 23. Zoom web page 24. Customize popup menu...
 
tabbed browsergogo explorerweb browserdownload toolhigh speed
PaintStar

Freeware by Zhenzhou Wang
65 x 2640Kb downloads

...Full suite of painting tools including paintbrush, pencil, eraser, airbrush, filter brush, color...and 26 methods of combining modes suppported. Transformation tools including rotate,scale,shear,perspective,flip,and wrap. Auto antialias supported. Image Morphing...gif animation or image file sequence. Gradient Fill tools include linear,radial,square,conical(symmetric),conical(asymmetric) and shapeburst. Multiple colors supported. Selection...
 
freewaremorphlayerpathscreen captureimage editor
Paessler Site Inspector

Freeware by Paessler AG
14 x 11877Kb downloads

Free Vista Files award
...standard screen sizes (e.g. 800x600) and you can zoom into a web page. An extensive selection of...
 
analyzingfirefoxgeckohtmlextensionscross browserinternet explorerwebpageanalysisboosterweb authoringpaessler site inspectorbrowser toolmozilla
FotoTagger

Freeware by Cogitum LC
36 x 3298Kb downloads

Free Vista Files award
...FotoTagger is a free software tool for annotating images and image areas quickly and easily, organizing images and grabbing them directly from browser. Place on an image movable annotation notes...
 
livejournalnotecommentbloggerphotoannotatedflickrpublishtagsharecalloutdigitalmetadataimage macropicturetoolimageboardjpegcamera
Paint.NET

Freeware by Rick Brewster
33 x 1600Kb downloads

...image to black and white, or sepia-toned. Powerful Tools Paint.NET includes simple tools for drawing shapes, including...been cited as an innovative improvement over similar tools provided by other software. The facilities for creating...enough to be picked up quickly. Other powerful tools include the Magic Wand for selecting regions of...
 
photoshopphoto editinggimppaint softwareimage editing softwarephoto editing softwarepaintnet
...The classic freeware image viewer reborn. Sleek, completely redesigned thumbnail viewer with support for slide shows, full screen viewing, video, image conversion, printing, and more. Version 5.0 adds video,...
 
picture viewerone catadobethumbnailpsdfreephoto viewerphotoshop
ABF Magnifying Tools

Shareware by ABF software, Inc.
32 x 2073Kb downloads

...ABF Magnifying Tools is a set of useful graphics tools for...has its own unique behavior and usability. All tools supplement each other and allow designers and people...cursor in different zooms. This set of different tools covers any preferences of various users. ABF Magnifying...
 
pickermagnifypixelzoomglasscolormagnifyingmagnifierlensabfcursorscreendesktoparea
Active Suite

Shareware by Actives Softwares
20 x 28362Kb downloads

...fix an uneven horizon,...), or use the powerful tools for advanced retouching features. With Active Studio, apply...sounds, and add your titles. Use the automatic zoom feature to animate your photo during the slide...
 
slidechangercalendarimageretouchautomaticwallpaperbackgroundsharewaredesktopdailyphotopictureshownotealarme
IconX

Shareware by Stardock Systems
33 x 1566Kb downloads

...can put shadows, make them bigger, have them zoom up when you put your mouse over them,...
 
desktopcustomizationstardockwindowblindsanimateicon toolsicons
Appointment Book

Commercial by Appointment Book
32 x 18300Kb downloads

...There is also a unique Scale Tool to zoom in and out plus a Scroll Tool for...
 
timetableappointments bookelectronic calendarschedulingtimesheetsoftwareschedulebookingsmyobquickbooks
KzxCadT

Demo by Kzx Software
18 x 4619Kb downloads

...in your work area. Have all the standard tools in hand as circles, lines, rectangles, arcs and...copy, move or delete any of your dimensions. Zoom in , zoom out and pan your work...area, dynamic zoom and zoom previous. Snap to all points in your objects...
 
sheet metalgcodeautolispsharewareflatcad software
DiagramStudio

Shareware by Gadwin Systems, Inc.
23 x 16378Kb downloads

Free Vista Files award
...with a comprehensive but rather unsophisticated set of tools that enable even the most "drawing-challenged" folks who...internal editor of images with transparency support, full zoom and pan features and much more. DiagramStudio 5.x...
 
flowchartinggenealogysoftwareorganizationgenealogicaldesignnetworkfamilygraphicsentitycomputerdrawpresentationbusinessdatadrawingprocessdiagramlinearrowstreeprogram
hsCADView

Demo by Hachisoft Corporation
13 x 17782Kb downloads

...View, print, zoom, pan, rotate & measure 2D/3D Cad Files (DWG, DXF, DWF,DXB). Convert between various document types (DXF, DWG, DWF, and DXB) and versions (r12, r13, r14, AutoCAD...
 
panrotateconvertdxfpdfautocaddwgviewprintimagebmpjpegdwfaudit
Antechinus Animator Professional

Shareware by C Point Pty Ltd
31 x 13736Kb downloads

Free Vista Files award
...images by further 40-65% with the best compression tools available. The preview lets you see how the...(.dll). Never before seen precision polygon/freehand capturing with zoom preview. Capture images directly from scanners, cameras and...
 
avi softwaresoftware for animationdownload animation softwarempg2avicomputer animation softwareavi2mpegvideo capture screenmpeg2avigif animation softwarescreen capture software
Instant Demo

Demo by NetPlay Software
12 x 9707Kb downloads

Free Vista Files award
...of special effects to grab the viewer`s attention. Zoom and pan, callouts, highlights and cross fades add...to use an application, Instant Demo has the tools that you need. Instant Demo screen recording is...
 
screen castscreen capturescreen recordingtutorial softwarepresentation softwarescreencastyoutubescreen recordermp3flashflash tutorials
...used for presentations, flyers, or brochures. You can zoom in and out of an image, cut, copy...amount of time. All of the image manipulation tools are available on the screen, and may be...
 
image editingscreen grabbercapture screenscreen capturescreen capturing