1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
FontList

Freeware by Edwin Martin
74 x 71Kb downloads

Free Vista Files award
...can change the style of a font and zoom in on a font. You can also view...
 
fontsbrowsebrowsershowviewermanagelisttypemanager

Freeware by Pawsoft
35 x 1253Kb downloads

...Advanced image viewing, browsing and management. Features include a fully resizable interface for both main dialog and file browser, new thumbnail browing mode, favorites folders system complete with favorites manager,...
 
metafiledigicamimagecameradeletecapturezoomgrabcopybitmapmanagerviewjpegformatcustomcursorbrowserenameedithistorymovegraphicfavoriteicon
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...thumbnails, organize files, change wallpaper, convert, rotate, resize, zoom and print images. With support for over 20...the dynamic playlist editor. Use the integrated file browser to navigate easily through your image files, viewing...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Zoom Player FREE

Freeware by Inmatrix
42 x 4900Kb downloads

...the best things in life are free, and Zoom Player Home FREE life delivers. The most powerful...AAC, DTS, Dolby Digital, FLAC and many more. Zoom Player is the most Powerful, Flexible and Customizable...less hassle, improved stability and greater performance. Behind Zoom Player`s classic media player look, hides a powerful...Audio Equalizer, Bookmarks, Play History and many more. Zoom Player`s media center simplicity makes it ideal for...
 
divxmpeg4aspect ratiozoom playerbest playermultimediaxvidmedia centerhtpcvideoblu-rayblurayh264projectoraudiomedia playerdvd
Gogo Explorer

Freeware by Gogosoft
22 x 1749Kb downloads

...web page as picture 22. Domain completion 23. Zoom web page 24. Customize popup menu...
 
tabbed browsergogo explorerweb browserdownload toolhigh speed
Crawler 3D Earth Screensaver

Freeware by CRAWLER, LLC
134 x 9102Kb downloads

Free Vista Files award
...and hurricanes. Receive weather forecasts, explore foreign countries, zoom in and out and rotate the globe. 3D...fire, 3D earth, and 2D slideshow. Enliven your browser with colorful IE browser skins, choose from over...
 
earth mapplanet earthdesktop saverssatellite image earthsatellite picture earthearth satelliteearth viewerearth saverearth screensaverscreen savers
Paessler Site Inspector

Freeware by Paessler AG
25 x 11877Kb downloads

Free Vista Files award
...Paessler Site Inspector is a web browser that combines the two most frequently used browser...internal browser, users can switch between the two browser engines with just one mouse click, for example...features can be accessed from within the Analyzing Browser as well, with convenient toolbars that Site Inspector...page as a bitmap to the clipboard. The browser window can be resized to various standard screen...sizes (e.g.
 
analyzingfirefoxgeckohtmlextensionscross browserinternet explorerwebpageanalysisboosterweb authoringpaessler site inspectorbrowser toolmozilla
FotoTagger

Freeware by Cogitum LC
46 x 3298Kb downloads

Free Vista Files award
...FotoTagger is a free software tool for annotating images and image areas quickly and easily, organizing images and grabbing them directly from browser. Place on an image movable annotation notes...
 
livejournalnotecommentbloggerphotoannotatedflickrpublishtagsharecalloutdigitalmetadataimage macropicturetoolimageboardjpegcamera
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...The most complete, all-in-one image and video solution currently available. Allows for fast viewing, editing, and management of all your image and video formats! Read and write support...
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer
PrintPunk

Freeware by JafaSoft
16 x 490Kb downloads

Free Vista Files award
...of printing you desire. PrintPunk allows you to zoom in and out on web pages while browsing...or shrink any web page to fit the browser window automatically. You can also hide the images...
 
webpageresizecutoffprintautofit
febooti ieZoom toolbar

Shareware by febooti software
23 x 504Kb downloads

Free Vista Files award
...Internet Explorer toolbar - browsers / webmasters tool to zoom in and zoom...out internet pages, zoom web sites. Pick colors using html color names...rgb color codes) and html color names. Resize browser window using presets. Define keyboard shortcuts. Use custom...streams. Built-in Auto Fit Print Preview option makes ieZoom toolbar the ultimate web printing assistant. There is...to experience cropped margins or deformed layout anymore.
 
zoom websiteprint web pagefit printauto printinternet printzoom internetzoom browsertoolbarauto fitzoom web sitezoom web page
Alteros 3D

Shareware by Lighttek Software
34 x 2919Kb downloads

Free Vista Files award
...png, ppm and other image formats supported. - Zoom in/out modes, screen floating. - Set any picture...
 
videovrmldigitalcadviewerexplorerlightwavephoto3dsautorunfullscreenbrowserplayerslideshowbrodyagacomtruespacemp3flashjpegdvdmaxinterfacepicturesico
Aros Magic Viewer

Freeware by Aros Magic
33 x 27Kb downloads

Free Vista Files award
...support; slideshows; Unicode compliance; multi-language capability; an intuitive zoom control and Web browser integration with IE and...
 
parallel processingsmallfastestfreejpegimageviewerdigitalphoto
eRez Imaging Server

Demo by YaWah.com ApS
28 x 99125Kb downloads

Free Vista Files award
...and create dynamic images for any use--from a browser - anywhere - anytime. Enable users on the...Internet to zoom in and examine image details. Manually preparing and...
 
zoomslideshowdynamicpanconvertimage server
Barcode ActiveX Professional

Demo by Morovia Corporation
24 x 2744Kb downloads

...writing any code. Advanced view features. You can zoom in and zoom out programmatically, toggle the human...display and so on. Generate Barcode Images in browser or in web server. This barcode ActiveX allows...
 
barcodemoroviavisual basicisbncode 128code39upcbarcode activexvisual studiolabel
1ClickPicGrabber with FloatBar

Shareware by Zabersoft inc.
23 x 2753Kb downloads

...And with the new FloatBar you can even ZOOM pictures directly in your browser. On top of...or adware whatsoever and takes up very little browser real-estate. For more information please go to www.1cpg.com!...
 
websitemoviespictureswebpagepastecardsstablepicture filesfastpicture grabberinternet explorersend e-cardsanalysiseasypicturegrabberdownloadergrabbingpasteoffice
Dream FlashSee

Shareware by Dream Soft
32 x 1660Kb downloads

...load Flash movies one by one in your browser any more. You can search Flash movies with...play Flash movie in full screen mode and zoom in/out as you wish, and also can save...
 
create screen savermake screen saverflash screen saverbrowse flash thumbmacromedia flash playercreate screensaverflash movieconvert swfflash applicationconvert flashexe swfswf exeswf fileswf2exeexe2swf
WebAsyst Quick Pages

Commercial by WebAsyst LLC
20 x 2441Kb downloads

...results are displayed in standard search engine format. Zoom in/out function for text. Quick Pages is accessible...anytime from anywhere via standard Internet browser or Windows Client. WebAsyst Windows Client is seamlessly...
 
page design softwareinstant web publishpage organizercontent managementweb siteweb page editoronline content managementweb publishingorganize pages
Free Vista Files award
...plus languages), 88 news providers, 52 email providers, browser tracks remover, (removes: Cookies, Cache, IE Auto fill,...and where you go on the Internet private. Zoom In/Out of web pages, auto highlighter for search...
 
internetspelladvancedlocaltoolbarfillcheckersearchbarloginautoexplorer
ATAF-Picture-eShop

Shareware by ATAF Software
19 x 2544Kb downloads

...viewing Direct upload of pictures from the users browser to the web application, no server components needed...Full searchable picture database Advanced thumbnail view with zoom function Picture rating Copyright protection of pictures Online...
 
eshoppicture shopweb galleryonline galleryuploadgalleripicture gallery