1 2 3 4 5 6 7 8 9 ... 19 20 21 22 23 24 25 26 27 28

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...without coding. The support for virtually all relational databases and legacy databases makes the ASP Report Wizard....
 
simple chartsxmlexport datatime series reportsmultiple column sortingjoin tablessql servercsvweb reportssimple graphreport writerdatabasesaccessexcelonline reportingdynamicreport wizardasp
...The CCU is designed to minimize the time needed to create skeleton code in a variety of languages. It allows users to define objects in a friendly GUI or to...
 
ddllanguageswinggeneratorhtmloraclejavajavascriptprogrammingtranslationxmltorqueskeletonexportcodedynamoconversionaspvisual basicimportextrapolationobjectbeanmakerdevelopmentsqlvalidationejbdynamic
Database Manager

Freeware by Inner-Smile.com
27 x 816Kb downloads

...This tool will support you in your database management activities for dBase-compatible tables, especially if you...are a user of Vista Software`s Apollo Database engine or the Advantage TDataSet descendant or MySQL...Advantage driver), converts between Windows and DOS charset, XML export of tables for easy, standardized data exchange,...(hidden) records), supports deletion, adding, editing and converting database records, displays table statistics, displays and...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport
Cogitum Co-Citer

Freeware by Cogitum LC
20 x 465Kb downloads

...Cogitum Co-Citer is a tool for creating and managing collections of texts from the Internet. It captures the selected text, Internet address where it has been found, its title,...
 
contentgrabinternetcollectiondatabasehtmlciterknowledge managementcitationplug-inbrowserxmlcapturetext
Kalimages Basic

Freeware by Soft Experience
31 x 3267Kb downloads

...collection more accessible, searchable, navigable creating a pictures database with preview, thumbnails, descriptions and other IPTC/IMM meta...keywords or any other information, analyse occurrences, create XML or HTML outputs even integrate with FOP processor...
 
generate thumbnailsiptc metadata extractioniimcaption-editingcapture iptckalimages basicdigital photosphoto collectionannotationsphotographersfind imagesphoto softwarecatalog photosfind photos
TrID

Freeware by Marco Pontello
39 x 29Kb downloads

...fast and automatic way. TrID uses an XML-based database of definitions which describe recurring patterns for supported...
 
recognizebinarytrididentifytridscan
TrIDNet

Freeware by Marco Pontello
15 x 33Kb downloads

...fast and automatic way. TrIDNet uses an XML-based database of definitions which describe recurring patterns for supported...
 
tridscanguiidentifyrecognizebinary
newObjects ActiveX Pack1 family

Freeware by newObjects
30 x 2590Kb downloads

...data manipulation on low level 9) Embedded SQL database engines (SQlite2 and SQLite3 based ActiveX) 10) Cryptography...
 
sqlshortcutdatabasecomponentstoragejscriptfilethreadvbscriptcollectionlibraryrecordcryptographybinaryflataspstream
FastQuery for SQL Server

Freeware by Dotco Software Ltd.
17 x 16354Kb downloads

...backup and restore databases. * Export tables to XML / Excel files. * Perform text searches on...
 
stored proceduresquerybuildertriggersvisual query buildertablessql serverdatabaseviews
BaseX

Freeware by BaseX
2 x 6198Kb downloads

...BaseX is a light-weight and high-performance XML database system and XPath/XQuery processor, including support for the...Text and Update Recommendations. It supports very large XML instances and offers a highly interactive frontend. BaseX...
 
xmlsqlxqueryxsltjsonxpathdatabasefull-text
...uses MSDE or MS-SQL Server 2000 as its database engine. If you host 3f Software Planner on...
 
enterpriseprojectmanagementsdknon-billableganttdiagramtrackingwebplanninginternetxml
Toko Content Editor

Freeware by Toko Web Service
23 x 104Kb downloads

...editing Pre-defined areas on any web page or XML file without any need for programming skills. The...for as many users/sites in your domain. No database is required. Simply use your web browser to...
 
contenttokoeditorweb
Developer`s Tips & Tricks

Freeware by F.S.L. - FreeSoftLand
26 x 2777Kb downloads

Free Vista Files award
...(Visual, Just), Perl, Phyton, .INI files, Scripts, SQL, XML and much more) - Code Snippets (Tips) manager...
 
source codedeveloperstipscollectioneditorcode snippetsdouble workingarchivetricksexamples
...framework. Other classes are: - Distributed computing - Database abstraction layer (Oracle, MySQL, PostgreSQL, and SQLite) -...
 
klorofilcomponentcollectiontelevokeklorofil platformopen sourcephp guiclassesgambartdistributed computingphp encoderframeworkfreesemoknetworkingxmlsmsdatabase abstractionsaltaneralibraries
0$ Mass Mailing freeware Paseo

Freeware by Paseosoft
29 x 28710Kb downloads

...Mailing Paseo is open source; It is an XML script which needs PaseoExpress freeware to run (included...in zip file): http://www.paseosoft.com/focus/focus-paseoexpress.php PaseoExpress is a graphical xml development freeware for operations managers and developers that...Model and generate your operational scripts graphically in XML format. Configure 33 process .net components such as...
 
freewaremassmailingemailingtextmailse-mailingpersonalizesmtpdatabasemass mailing mass-mailingmass senderfile
SQLiteSheet

Shareware by SoftOL
13 x 811Kb downloads

...with SQLite3 becomes easy. Tool for administration of databases SQLite. The Program allows: -Modify database (create table,...DBF files Export to DBF files Export to XML from SQLite Export to HTML from SQLite Support...
 
admindatabasesqltoolsqlite
...with powerful screen layout capability, a standalone SQL database engine or ADO database connectivity, XML parsing, full...communications. Whether you are using the built-in SQL database (based on SQLite) or connecting to SQL Server,...MySQL, an Access database or any other ADO data source Protara let`s...
 
developerformsdatabaseprotaradesignjavascriptrapid application developmentdebuggerbuild applications
Feed Submitter

Shareware by Fastlink2
7 x 1718Kb downloads

...Feed Submitter is the easiest semi-automated blog and RSS feed promotion tool ever. With our software, you will never have to search for places to submit your RSS feeds...
 
xml submitsubmit xmlrss submitterblog submitrss databaserss feed submitfeed submitterxml feedupload rssrss toolpublish rsssubmit rss feed
WebCab Functions for .NET

Demo by WebCab Components
19 x 3320Kb downloads

...of one variable; to your .NET, COM, and XML Web service Applications. The interpolation procedures provided include...the following technology aspects: 3-in-1: .NET, COM, and XML Web services - Three DLLs, Three API Docs,...product. Offering a 1st class .NET, COM, and XML Web service product implementation. Extensive Client Examples -...examples including .NET (C#, VB.NET, C++.NET), COM and XML Web services (C#, VB.NET) ADO Mediator - The...
 
interpolationbicubicextrapolationcubic splinesclass librarieslagrangenewton polynomialsburlisch-stoerxmlweb servicevbnet
WebCab Functions for Delphi

Demo by WebCab Components
15 x 2929Kb downloads

...of one variable; to your .NET, COM, and XML Web service Applications. The interpolation procedures provided include...the following technology aspects: 3-in-1: .NET, COM, and XML Web services - Three DLLs, Three API Docs,...product. Offering a 1st class .NET, COM, and XML Web service product implementation. Extensive Client Examples -...for .NET, C#, VB.NET for .NET Components and XML Web services. ADO Mediator - The ADO Mediator...functionality of our .
 
vbnetburlisch-stoerweb servicelagrangebicubicnewton polynomialscubic splinesdelphiextrapolationxmlinterpolationclass libraries