1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
264 x 11118Kb downloads

...all network releases, also all background connections of exchange programms like Kazaa or Emule, Netmeetings and chatsystems...like ICQ and Yahoo.It shows exact Windows system information. P3D coding technology . New Modul,...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
...Project Planner Reader (PPR) files to MS Project Exchange format(MPX), which can be viewed using MS Project...
 
project plannermicrosoft projectms-projectsmartworksmpxmpp2pprfree
Mach5 PopMonger Regular

Freeware by Mach5 Development
61 x 2782Kb downloads

Free Vista Files award
...set up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background....and Scripting requires a PopMonger Gold license. Supports Windows 2000, Windows XP, & Windows Vista. AdWare and...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
ManageEngine Applications Manager

Freeware by ZOHO Corp.
91 x 49152Kb downloads

...of the following services : JMX applications, Microsoft Exchange Server, Service Monitoring (any TCP/IP port),SNMP Agent,Web Server...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
ManageEngine OpManager

Freeeware by AdventNet Inc
115 x 39569Kb downloads

...purchased at a later date. OpManager supports both Windows and Linux platforms. - Apart from device status...also monitors VMware ESX servers, Applications, MS-SQL, MS-Exchange, Windows services, Event logs, Active Directory, VoIP, WAN links,...
 
network monitoring toolnetwork management softwareserver management software
Pivo DnsResolver Component

Freeware by Pivo Corporation
43 x 232Kb downloads

...can be used from ASP.NET web pages, to windows forms, to web services. The Domain Name System...for each host name, and lists the mail exchange servers accepting e-mail for each domain. The DNS...
 
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
Browse3D

Freeware by Browse3D Corporation
25 x 2188Kb downloads

...search and anti pop-up features are integrated with Windows XP SP2. Save time by loading links from...of your research containing multiple web pages, and exchange these rooms with colleagues or friends. Browse3D, the...user the option of where to load new windows (h) Compare multiple shopping or auction items side...
 
internet browserweb browserbrowse3dsave rooms information
EzInstall

Freeware by Soft9000.com
35 x 904Kb downloads

...create a self-extracting installer and de-installer for Win32. Exchange your program, archive, web-pages, or other files without...being an EzInstall-produced program. Simply run "EzInstall.EXE" under Windows NT, 95, 98, 2000, ME, XP, WIN32 emulators...
 
self-extractingremovereasyinternetcompressedfreeftpscreensavercompressionsingle fileexeself extractingwin32windowsinstallerssoftwaredisclaimer
Aplus DivX to PSP Converter

Shareware by Aplus Software Inc.
39 x 7557Kb downloads

...digital video. Often used on the Internet to exchange video files.Originally developed for DVD encoding , DivX...best picture and audio quality.. * OS Supported: Windows 98/ME/NT4/2000/XP/2003/Vista * Hardware Requirements: Intel Pentium II 350MHz...
 
rmvb pspmp4 pspmpeg1 pspmov pspwma pspdivx pspxvid pspvob pspmpeg pspavi pspmpeg2 pspwmv pspswf pspmp3 psp
...Email Templates is an extension to Microsoft Outlook designed to send personalized messages rapidly to individuals and multiple recipients. Email Templates has the ability to create customizable message templates, speeding...
 
outlook 2000emailadd-insaddinssharewaremicrosoft outlookutilitiese-mailwindows messagingexchange serveroutlook 2002
Tech-Pro Utilities Collection

Freeware by Tech-Pro Limited
22 x 1412Kb downloads

...Tech-Pro Zip, Clock Sync and many more. No Windows user should be without this suite of tools....you like them, become a registered user in exchange for a small donation....
 
launcherwindowsdesktopzip managercalendarsystem trayeditorutilitiesmenu
Easy2Sync for Outlook

Freeware by ITSTH
48 x 9250Kb downloads

...works with normal PST files as well as Exchange server accounts. You can either synchronize your data...the sync automatically. The software can synch at windows startup or shutdown, at time intervals or certain...
 
netzwerkmicrosoft outlooknotebooknetzwerktoolslaptoplansynchronize outlooksynchronize pstsync outlook
Database Manager

Freeware by Inner-Smile.com
27 x 816Kb downloads

...BDE engine, Apollo driver, Advantage driver), converts between Windows and DOS charset, XML export of tables for...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport
newObjects ActiveX Pack1 family

Freeware by newObjects
30 x 2590Kb downloads

...offers the same functions on wide range of Windows variants thus providing convenient component library for applications...and providing the same features for all the Windows based devices. In contrast to the most ActiveX...Host application - the same for Desktop and Windows CE (all versions)....
 
sqlshortcutdatabasecomponentstoragejscriptfilethreadvbscriptcollectionlibraryrecordcryptographybinaryflataspstream
ManageEngine ADManager Plus

Shareware by ZOHO Corp.
34 x 36864Kb downloads

...bulk-creation of AD objects with all properties including Exchange attributes in just a few clicks, or by...This product supports even the latest version – Exchange 2010. The comprehensive and comprehendible reports present consolidated...
 
active directory workflowpassword managementactive directory automationsecurity delegationreport active directory usersexchange managementwindows network managementlogon reportsbulk user management
Recipes Ship

Freeware by Recipeship inc
60 x 1751Kb downloads

...use recipe software that allows you to collect, exchange and organize your recipes and much more. Print...functional recipe manager software. Operating system - MS Windows 95 / Windows 98 / Windows 2000 /...Windows ME / Windows XP / Windows 2003 This is a Freeware....
 
desserthalloweenfishpumpkinporkcookbookmothers day recipesfruitschristmas recipescakessoupschefscookiesseafoodsaladscooking
dotSilver Partner

Freeware by Skalfa eCommerce
24 x 542Kb downloads

...DotSilver Partner is a feature-rich dating website script implemented on a bleeding-edge technological base. We delivered the software with the simplest and smoothest yet funny user experience with...
 
matchmaking website scriptdating softwaredating scriptmatchmaking softwarematchmaking scriptdating website scriptpersonals softwarepersonals scriptpersonals website script
Serial Com Port Monitor

Shareware by COM Port Software
17 x 3471Kb downloads

...Monitor displays, logs and analyzes all serial data exchange between serial devices and any application. This tool...
 
monitor com portserial port controllerrs232 analyzeradvanced serial port monitorport monitor softwarewindows port monitormonitor serial portserial port monitoringserial com port analyzercom port monitorrs232 port
...TV is a Free, Easy To Use, MS Windows Based Program That Checks the Link Popularity Status...
 
link popularitylink buildinglink exchangesearch engine optimizationexpired domains
Visendo Mail Checker Server 2006

Shareware by ppedv AG
10 x 10791Kb downloads

...run it without any security concerns on your Exchange Server. The mail traffic is filtered by different...the MMC. The server runs as service under Windows NT, 2000, XP or Windows 2003. All small...
 
emailserver integrationanti spamvirusexchangeserver based