1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24

Sort by : ReleasedNameDownloadsAddedRatingRelevance
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...that lets you get the feel of your website traffic. See volume of traffic from page to...annoyances. Mach5`s FastStats Analzyer gives you the cool tools you need to examine your web site traffic....
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
EasyLogin

Freeware by Iconico
80 x 341Kb downloads

...for Internet Explorer allows you to log into websites using a single mouse click. Version 1 is...email to someone else, or add to a website - Once created the EasyLogin bookmark will work...in any modern browser - Tested on many websites including gmail, yahoo and aol - Totally free,...
 
toolsexplorertoolbarsinglewebsiteseasylogininformationinternetusernamespasswordclickbutton
Idaho-Web-Counter

Freeware by Implied By Design
99 x 248Kb downloads

...Idaho-Web-Counter is a small and simple way to add cool counters to your web site. Just click on the counter style you want and the program will copy...
 
web page designweb design freewarewebsite designhtml designhtml toolsweb toolsfree web softwareidaho web counter
Keyword Crawler

Freeware by webkeysoft
123 x 413Kb downloads

...Online website optimization tools: explore and see your site like...
 
metaoptimizationbacklinkspiderbalisedisplaytoolssitemapfinderwebsitekeywordsearchxmlcrawlparservisitorpagerankbrokeninternalgoogle
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in validation. Rookies, get...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...everyone - not too shabby, eh? With valid website code, your pages display consistently in...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Associate-O-Matic Lite

Freeware by Associate-O-Matic
70 x 2074Kb downloads

Free Vista Files award
...or add a shopping area to your existing website or blog. Free download. Control the look and...
 
affiliate shopassociate shopaffiliate storeassociate mallassociate storeaffiliate mall
eBay Companion

Freeware by EasyBitSoft
59 x 1515Kb downloads

...a powerfull program containing several usefull Links and Tools for the world`s fastest growing online marketplace! Now...
 
ebay toolshow ebayebay softwareebay businesshomebase businessfree ebookonline businessshopping ebayebook ebay
Whois

Freeware by Nsasoft US LLC
71 x 617Kb downloads

...address, or a domain registration information . See website information, search the whois database, look up domain...
 
net toolsdomain toolsdomain infowhoisnetwork softwareinternet toolsnetwork tool
...sound (.wav), Adobe *.pdf files, Power Point *.ppt, website *.htm , *.doc, *.xls or stand alone *.exe...software will also allow you to create a website as well as all of the CD text...
 
cmspowerpointmedia libraryvideocontent managementbrochuresmultimediaminicatcatalogue
TrafficSeeker - Lite Free Edition

Freeware by WebGrip, Inc
35 x 2885Kb downloads

...Are you looking to increase your website`s visibility and ranking? Do you want to generate greater sales? If so, then TrafficSeeker Lite - Free Edition is for you. TrafficSeeker Lite -...
 
web site promotiontrafficseekersearch engine submissiontrafficbuildersearch engine optimizationseotraffic seeker
Software Promotion Toolkit

Freeware by Software Submit.NET
18 x 2392Kb downloads

...for your software promotion needs. This toolkit contains tools and information that is needed to successfully promote...» FREE software submission to 20 download sites Website promotion category » Search engines submission » Search...Marketing services category » Software promotion services » Website promotion services » Hosting services » Software registration...services » Website templates Content of this toolbox is constantly updated....
 
software marketingshareware distributionsoftware submitsearch engines submissionsoftware submissionsoftware distributionshareware promotionsubmission serviceshareware marketingsoftware promotion
Web-Host-Uploader

Freeware by Notepad Web Design
34 x 280Kb downloads

...is a simple FTP tool which uploads local website changes to a web host with a single...FTP client. For webmasters who create and maintain websites locally this little application saves time and tedium...extension). Henceforth, whenever changes are made to the website documents, just double-click the .upload task file to...web host. Once Web-Host-Uploader is implemented, updating your website becomes quick, easy and error-free. This is one...
 
web serverweb page hostingweb site designweb serviceweb hosting servicesweb designweb site hostinghtml toolsweb page designweb design freewarefree web hostingweb site traffic
...Google has created a fantastic set of tools to allow you to translate any web page...rescue to help solve that problem using the tools put out by Google. The interface helps you...translate pages, and you can have your entire website translated into multiple languages. Most important, you are...
 
wizardsinternet utilitiespage translateweb building toolsgoogle translateweb authoringwebmaster toolsjavascript downloadslanguage toolpower web tools
Wavepad Audio Editor

Shareware by NCH Software
205 x 887Kb downloads

Free Vista Files award
...such as CD Quality and Radio Quality * Tools include spectral analysis (FFT) and speech synthesis (text...
 
wavepadmp3 editmusic editing softwareedit musicmp3 editorwav editormusic editor
ViziFlow

Freeware by John Beeteson
33 x 1530Kb downloads

...aerofoils. Example files are included, and many editing tools are provided. A flowrate and pressure gauge is...also available. A website gives a message board to exchange views....
 
modelingstreamlinesaerofoilmeasurementvisualizing fluid flowaerodynamicspressure
...have to specifically tell WebAssistant to capture a website - it remembers everything you see, automatically adding...
 
cache archivefreewareweb site collectionoffline browserjavaweb browsing toolsbookmarkoffline browsingnavigationknowledge managementoff-line readersurfdownload web sitesinternet
AutomaticSearch

Freeware by 4ComTech
18 x 1682Kb downloads

...links, subjects, and topics associated to the current website you`re viewing. It features an integrated search engine...You can also save and access your favorite websites easily by using toolbar buttons....
 
search utilitiessearch toolsautomaticsearchrelated links
ToolsPackage

Freeware by Detlev Schaefer
62 x 893Kb downloads

...The ToolsPackage includes 57 small tools which can be started without installation. There is...
 
shortcutsscreen saverclockcalendar weekwatchboardgameeurowebdesignhtmlasciicurrencyconverthexclipboardcalculatorxml
FXWitz Flash Photo Portfolio

Freeware by INNER Studio srl
38 x 25000Kb downloads

...FXWitz Multimedia Portfolio: Makes, Publish online, Update Your Multimedia Portfolio with the images of new works every time you desire at zero cost independently all in Flash with a few...
 
image editingphotographer web templatesdigital photographyart templatesillustrator web templatesportfolio websitearchitects web templatesflash toolsphoto templatesgallery templates
Fresh FTP

Freeware by FreshWebmaster.com
40 x 2377Kb downloads

...Protocol) is a useful tool for webmaster or website owner to upload or download web content (html,...graphic, sql backup file, website statistic, etc) from the server. It supports ability...
 
windows ftpfree ftp softwareftp toolftp internet explorerftp toolsftp transferftp client windowsftp directoryhow use ftpftp connectionftp spaceftp setupftp downloadsftp windows 2000enable ftpftp client downloadset ftpfreeware ftp clientf