1 2 3 4 5 6 7 8 9 ... 35 36 37 38 39 40 41 42 43 44

Sort by : ReleasedNameDownloadsAddedRatingRelevance
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...Bandwidth, Search Keywords and Phrases, Referrers, Visitors per day, Most...that lets you get the feel of your website traffic. See volume of traffic from page to...
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
...of eBay(R) to your living room. You can search for items, browse in the eBay categories or...completely free to use. Donations are welcome (see website for details)....
 
bidmedia centerbuyauction
Keyword Crawler

Freeware by webkeysoft
123 x 413Kb downloads

...Online website optimization tools: explore and see your site like...
 
metaoptimizationbacklinkspiderbalisedisplaytoolssitemapfinderwebsitekeywordsearchxmlcrawlparservisitorpagerankbrokeninternalgoogle
Cayman Browser

Freeware by caymanbrowser.com
77 x 1677Kb downloads

...click automatically *Incredible Search: Includes more than 500 search engines and 100 search categories *Flash animation filter:...
 
webbrowser
Ezilon Toolbar

Freeware by Ezilon Directory
57 x 239Kb downloads

...features include: a pop up blocker, ability to search the world using Ezilon,major search engines search, Alexa...PR check, Wayback machine (to find how the website looks way back), ability to check images, world...news search and also the ability sign up and check...
 
image search toolbaralexa tool barspop blockerpop stoppersearch engine toolbars
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...everyone - not too shabby, eh? With valid website code, your pages display consistently in different browsers,...and are more accessible for disabled users and search engines. There`s also the satisfaction that comes from...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
AlterWind Log Analyzer Lite

Freeware by AlterWind Software
66 x 2271Kb downloads

...web site usage statistics, referring sites, traffic flow, search phrases and much more! AlterWind Log Analyzer Lite...supports 430+ search engines from 120 different countries. Reports generated by...estimate the auditory of your site and increase website traffic. You will get all the necessary information...
 
alterwindsample reportwebsite statisticsloganalyzerconfiguration stringserver logssite mirrorslog analyzerapachelog analysislog files any format
rss2html

Freeware by NotePage, Inc.
83 x 28Kb downloads

...it will be in a format friendly to search engine robots. Using rss2html.php webmasters can customize the...
 
rss2htmlfreenews feedrdfphp scriptxml feedtoolconvert rss htmlconversionintegratecomponentconvert xml
Seecrets.biz Website Promotion Survival Kit

Freeware by seecrets.biz
83 x 701Kb downloads

...Win EXE format contains articles and tutorials on website promotion, website promotion, search engines, top rankings, tips,...not published anywhere. The ebook is ideal for website owners, webmasters or potential website owners to provide...a realistic picture of website promotion.
Contents:
- Introduction - A Gentle...Making Huge Losses in the Stock Market
- Search Engine Wars - a Different Perspective
-...
 
yahooebookgooglerelevancytipskeywordsnewswebsite promotionmsntop rankingssearch engines
Shark Email Extractor

Freeware by Logambo.com
249 x 440Kb downloads

...Shark Email Extractor is designed to search chosen files for email addresses and it automatically...extract all e-mail addresses from those file(s).You can search your entire system if you like, from your...you want to extracting email address from a website you can use our SharkMailHunt software....
 
email extractorshark email extractoremail harvestermass mailemail hunterclean mailing listshark genharvest email addressesbulk emailemail grabber
BackLinks Master

Freeware by CleverStat
60 x 1392Kb downloads

...very effective way to increase your rank in search engines. No matter how you got inbound links...
 
reciprocal linksbacklinks softwareback link
Whois

Freeware by Nsasoft US LLC
71 x 617Kb downloads

...address, or a domain registration information . See website information, search the whois database, look up domain...
 
net toolsdomain toolsdomain infowhoisnetwork softwareinternet toolsnetwork tool
Baseball Browser

Freeware by 4ComTech
22 x 1318Kb downloads

...delivers easy access to the best baseball news websites (ESPN, Fox Sports, The Sporting News, Sportsline, Yahoo...team websites, and topics associated to the current website you`re viewing. It features a configurable integrated search...
 
baseball browserbaseball software programscreate web browsermake your own browserhow create web browserbaseball web browserbaseball sports newsbaseball appshow build web browserfree baseball software
SportsBrowser

Freeware by 4ComTech
30 x 1398Kb downloads

...delivers easy access to the best sporting news websites (ESPN, Fox Sports, The Sporting News, Sportsline, Yahoo...Sports, etc), professional league websites (NFL.com, NBA.com, MLB.com, NHL.com, NASCAR.com etc) and professional...links, subjects, and topics associated to the current website you`re viewing. It features a configurable integrated search...
 
make web browservb6 web browservb6 webbrowsersports web browsersports softwareweb browser controlsportsbrowserhow make web browsersports browsermake your own browser
Free Vista Files award
...Local Website Archive offers a fast and easy way to...
 
local website archiveoffline readersave website
TrafficSeeker - Lite Free Edition

Freeware by WebGrip, Inc
35 x 2885Kb downloads

...- Free Edition offers a full suite of search engine optimization tools. Including: automatic submission to over...275 search engines , doorway page generator, meta tag generator,...
 
web site promotiontrafficseekersearch engine submissiontrafficbuildersearch engine optimizationseotraffic seeker

Freeware by Weather4you
36 x 339Kb downloads

...without having to open a browser window, or search a website for the information. Once the default...
 
rainsundesktop weatherweather forecastweather reportslocal weather
Software Promotion Toolkit

Freeware by Software Submit.NET
18 x 2392Kb downloads

...your software presence on the interent download sites, search engines and directories in a way to help...» FREE software submission to 20 download sites Website promotion category » Search engines submission » Search...Marketing services category » Software promotion services » Website promotion services » Hosting services » Software registration...services » Website templates Content of this toolbox is constantly updated....
 
software marketingshareware distributionsoftware submitsearch engines submissionsoftware submissionsoftware distributionshareware promotionsubmission serviceshareware marketingsoftware promotion
Tiny Toolbar

Freeware by SoftCab Inc
31 x 312Kb downloads

...usually type web addresses to surf the Web). Search add-on allows user to easyly search for any...information on popular search engines such as Yahoo or Google, alse it...has powerful local search feature. You can search files using complex file masks. Files that (do...tags are highlited. View whois information about current website (who is owner and administrator of a website,...
 
addonexplorertoolbarbrowserplugininternetbutton
Free Vista Files award
...using the integrated editor. Make sure that your website visitors do not leave your site because they...CSS. Correct HTML also makes it easier for search engine spiders to index your site. It`s also...
 
learn htmlhtml editorxhtmlhtml validatorcsesyntaxfix htmlwebspellhtml checkerinternet solutionsverifierfix webhtml code