1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Free Vista Files award
...presentation of PowerPoint slide shows (converted to Flash), Web Seminar, Desktop applications - say authoring tools, Presentation...server platforms, Web-based Authoring Tools, Web Conferencing applications, PowerPoint-to-Flash converting solutions and much more!Includes...efficient components for converting PowerPoint-to-Flash and customise presentation player view (source code included) for Cross-Platform and Browser...
 
ppt-to-swfconvert powerpoint flashpowerpoint-to-flashppt2flash sdkflash presentationsppt2swf sdk
oRipa Yahoo Webcam Recorder

Shareware by EjoyStudio
38 x 1865Kb downloads

...oRipa Yahoo Webcam Recorder is a handy tool to record Yahoo...Just press the record button as the Yahoo webcam is connected, and the video streams are saved...your preset folder. You can play the recorded videos back at any media player and at any...time you like! oRipa Yahoo Webcam Recorder supports the following features: 1. Work with...the above versions. 2. Real time record Yahoo webcam with optional sound recording (e.g.
 
oripawebcam recorderrecord yahoo webcamyahoo webcam recorderrecord yahoo messengerrecord webcam
Boomer Audio

Shareware by Segon Corporation
10 x 1670Kb downloads

...Create Flash web Buttons, Logos, Banner Ads or Slideshows for your...compression technology. Produces at your option a complete web page with the necessary HTML code generated by...compression technology. Produces at your option a complete web page with the necessary HTML code generated by...
 
flashswfbanneraudioformatmp3shockwave
Boomer Video

Shareware by Segon Corporation
15 x 1730Kb downloads

...Create Flash web Buttons, Logos, Banner Ads or Slideshows for your...compression technology. Produces at your option a complete web page with the necessary HTML code generated by...
 
formatshockwaveflashbannerimageanimation
Synops`Tools

Shareware by SYNOPS Editions
7 x 2505Kb downloads

...fonts, icons, pictures, sounds, spreadsheets, presentations, texts, videos, web pages... All media is displayed in a single...
 
docscanwavjpgpngmpegmusicphotoarchiveaudiopictureexploreviewericonpresentationgraphictextbmppptzipmp3spreadsheetsoundcursorfontplayergifvideoxlsmultimediadivxrtfttfimage
...Instant Video Suite Captures screen activity with voice & recorded...video via web cam, presenting HTML embedded with "live" multi-media flash...presentations ready to put on your web site. Comes with CD menu creator to create...presetations. You can also produce .avi files (traditional video files, usually large in size) from your presentations...then compress and stream them to flash video file (.
 
digital video streamingcapturing streaming videostreaming video playerscreen capturescreen capture programsflash video filescreen capture applicationcamtasia studiostreaming audio video
MySlideShow

Shareware by Anix Software
36 x 5021Kb downloads

Free Vista Files award
...create a standalone executable slide show or a video file (in different formats), an HTML web gallery,...or burn an autorunnable PC CD-ROM, Video CD or DVD and send it to your...your slideshow disc into their CD/DVD drive, MySlideShow player will automatically play the slideshow you have created....
 
web photo galleriestiffmyslideshowjpegmpegalbumdvdslideshow softwaretransitionspresentationvcdvideotransition effectsexif
Clip Downloader

Shareware by Kabware Developments
41 x 1318Kb downloads

...Download and save videos from YouTube with 1 click. Massive downloading capability...from any site on the Internet. Watch your video clips with the awesome built-in media player. Clip...Just provide the extension point it at the website and it is off. Use Clip downloader to...member’s area with easy. Just login using the web browser and click download when you want to...from any site on the Internet.
 
downloaderclip
TV Player Classic

Freeware by TV Player Classic
98 x 2102Kb downloads

...TV Player Classic is a program for view online internet...network streaming need a TV tuner, DV camera, Web camera or other video device. For most TV...
 
setinternetbuyonlineplayer classicplayer classic downloadpurchase
Audio Editor Express

Shareware by DanDans Digital Media
25 x 11056Kb downloads

...File, Mix, Mix From File) Extract audio from video files (support split-extracting) Convert audio from text (Text...you can play it on your stand-alone CD player Burn audio files to data DVD/CD to backup...you can play it on your stand-alone MP3 player Record new audio file from a microphone, sound...CD Player, MP3 Player, RealPlayer, Windows Media Player, Web Page, Internet Conversation, Internet News, Internet Radio Station...
 
audio editingaudio editoraudio convert
...The brand-new Ashampoo ClipFinder HD gives you web video the way it should be. Search in up...to fifteen video portals at once or in selected portals, view...click. Nothing makes finding, viewing, saving and managing web videos easier. And Ashampoo ClipFinder HD isn`t just...better, it`s cool. Enjoy videos on the revolutionary 3D Video Wall, download and...convert videos with only one click, play your favorite videos...
 
youtubeveohvideo playermyspacecomyahoo videogoogle videovideuvimeovideo sevenloadvideo viewerdailymotionmp3 downloadspikemetacafeclipfishlivevideoashampoo clipfindervideo search
Free Vista Files award
...Never Has Downloading Online Videos Been Easier Thousands of videos have been made...copy a video`s current http:// address from the web browser and paste it into Ashampoo ClipFisher: immediately,...your own little (or big, for that matter) video library is no problem at all. Of course,...reached, Ashampoo ClipFisher will simply break down the video file into several easy-to-handle fragments. Highlights: - Transfers...
 
metacafegooglevideomyvideovideo toolsyoutubevideumyspacemultimediaclipfishsevenload
Wondershare WebVideo Author

Shareware by Wondershare Software
15 x 7639Kb downloads

Free Vista Files award
...Wondershare WebVideo Author is your reliable choice of converting videos...mov,asf,wmv,rm,flv,) to flash movies. You may import existing videos to WebVideo Author, or capture your own video...by Webcam or DV. Not like other video to flash converter, WebVideo Author also empowers you...to manage your video clips in video pane, organize the time sequence on story board,...
 
mpg flvconvert avi flvvideo flashmov flvflash video converterconvert video flashflash video toolvideo flash converterconverting video flash
X360 Multiple Video Player ActiveX OCX

Shareware by X360 Software
19 x 907Kb downloads

Free Vista Files award
...X360 Multiple Video Player ActiveX Control helps application developers to control multiple...Visual Basic, Visual FoxPro, Delphi, MS Access, VB.NET web page, and C#.. The video formats include 3GP,...It helps programmer to create up to 10 video files playback at the same time. Each layer...plays a video and supports several properties such as ordering, alpha...use it to fully control the audio and video stream.
 
dotnetmovaccessmedia player activexavi video activexdivxwmvplaybackvistapageh264mpeg-4aspmovie activexrmvb3gpocx
x360soft - Video Player ActiveX SDK

Shareware by X360 Software
12 x 898Kb downloads

Free Vista Files award
...X360 Video Player ActiveX SDK helps application developers to fully control...the audio and video stream. The ActiveX works on most of the...Visual Basic, Visual FoxPro, Delphi, MS Access, VB.NET web page, and C#. The main features are play,...DDS format. Enable/Disable the overlay bitmap when the video is playing. Flip and mirror the overlay bitmap....
 
movie activexpagedotnetwmvwavh264ocxwmaplaybackmpeg-4accessasp3gpmidimedia player activexrmvbvideo activexdivxvistamp3
#1 Smart DVD Creator

Shareware by Smart Soft
15 x 364Kb downloads

Free Vista Files award
...So you can upload your movies from your web cam or video recorder and burn them on...over the Internet to enjoy on home DVD players attached to your TV or PC. And enjoy...
 
avi dvdconverter
Wondershare PPT2Flash Pro Xmas Offer

Shareware by Wondershare Software
15 x 12442Kb downloads

Free Vista Files award
...with animations and slides. Use the customizable flash player to organize the slides. Insert flash movie and...show. Streaming the audio, and convert the embedded video clips to FLV movie in the final output....
 
convert powerpoint flashppt flashflash presentationconvert ppt swfpowerpoint swfchristmasppt swf converterflash slideshow
x360soft - Multiple Video Player ActiveX SDK

Shareware by X360 Software
18 x 907Kb downloads

Free Vista Files award
...X360 Multiple Video Player ActiveX Control helps application developers to control multiple...Visual Basic, Visual FoxPro, Delphi, MS Access, VB.NET web page, and C#.. The video formats include 3GP,...It helps programmer to create up to 10 video files playback at the same time. Each layer...plays a video and supports several properties such as ordering, alpha...use it to fully control the audio and video stream.
 
accessmedia player activexdotnet3gph264movie activexavi video activexmpeg-4divxocxwmvaspplaybackrmvbvistapage
Apex VCD Ripper

Shareware by Apex Software, Inc.
105 x 15421Kb downloads

...Apex VCD Ripper convert VCD to any video as you like, It is designed to meet...and friendly user interface let you convert VCD Video with ease. The powerful features and unbeatable price...make Apex VCD Ripper an affordable and powerful video conversion solution on personal computer. 1.Extreme fast Conversion...2. Very Easy to Use. 3.Support converting VCD video from dat file to AVI, Divx, Xvid, MPEG,...MOV, WMV, RM, RMVB etc. PC Video 4.
 
dat avidat ipoddat wmvdat flvvcd video converterdat flashdat mpegdat movdat mp4vcd ripper
save2pc Light

Freeware by FDRLab, Inc.
41 x 3025Kb downloads

Free Vista Files award
...Free tool that downloads videos from Youtube or Google Video and saves it...local computer. Simply paste the URL of a video into the program, press Start , and the...into the selected folder. You dont need any players to play flash video just play it on...the defult media player clasic. save2pc allows you to easily grab and...use it. No need to use scripts for web browsers. Just run save2pc and start downloading!...
 
videograbmpegyoutubecatchgoogle