1 2 3 4 5 6 7 8 9 ... 44 45 46 47 48 49 50 51 52 53

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Paessler URL Recorder

Freeware by Paessler AG
92 x 740Kb downloads

...POSTDATA strings that a user sends to a web server while surfing a sequence of URLs. It...works like a standard web browser, whereby you enter a URL at the...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
FastStats Analyzer Free

Freeware by Mach5 Development
91 x 2851Kb downloads

Free Vista Files award
...Super-fast site log file analysis with SmartDNS lookup. Choose from...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...printing. Gold license adds Scenario Analysis, 17 addl Site Stickiness reports, TreeView Tags, and Report Export capability....Registration.
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
...anywhere in the world. This convenient remote administration tool is FREE of charge and is a separate...download from MDaemon. WebAdmin interface is compatible with Microsoft IE 5.5 and...Mozilla Firefox 0.9 and newer, and Safari browsers. WebAdmin has been updated to include new features and...MDAEMON 9.0.0 MDaemon 9.0.0 or later is required. WebAdmin has been updated to include new features and...introduced in MDaemon 9.0.0.
 
email administrationweb accessweb based accessmdaemonweb base accessrelayfaxweb base administrationworldclientweb administrationweb based administrationweb-based accessremote administrationweb-based administration
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
137 x 26624Kb downloads

...run at scheduled interval. The IP Address Manager tool automatically discovers the subnets from the routing tables...& Switch Port Mapper, it also provides various tools for Bandwidth Monitoring, Network Monitoring, Wake on LAN,...and more. AdventNet ManageEngine OpUtils provides real-time monitoring tools to troubleshoot poor network performance, heavy bandwidth utilization...it is absolutely free of cost.
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...controlled entirely by you not the software The webmasters tool will only pre-populate web pages and not...submit keeping you in control. Comprehensives list of sites to post to including over 160 RSS, PAD,...Blogg, Podcast, Shareware and Freeware sites. With the webmasters tool you will never waste time and money...on targeting the wrong keywords again. The webmasters tool is able to check MSN, Yahoo and Google...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
CodeThatHint

Freeware by CodeThat.Com
68 x 384Kb downloads

...a javascript widget providing the functionality of the tool tip (hint) control. It is represented by the...introduces some useful and helpful information and makes site or application evaluation more convenient by shortening the...
 
widgettipjavascripthinttool
Photo Resize Magic

Freeware by SOW
379 x 582Kb downloads

...Photo Resize Magic is a useful and easy-to-use tool for digital camera owners. This free software allows...to your friends by e-mail, upload to a web site, etc. Add some visual effects to your...
 
convertdigital photojpegtiffjpgconversionphoto resizer
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great...websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...new best friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
SEOSmart Future PR

Freeware by Recovery-Review.com
67 x 464Kb downloads

...checks 94 Google data centers to obtain your Web site`s Google PageRank with a single click. The...new SEO tool is completely free to use, and returns all...a domain name or purchasing links from a Web site? Make sure its PageRank rating is solid...and protect yourself from purchasing links from Web sites with inflated or dropping ratings by checking the...of the site`s PR rating.
 
recovery reviewproxysearch engine optimisationpagerank checkerpromotealexafuture pagerankgoogle ranksserptoolsseochataverage pagerank
Alien IP

Shareware by ArmCode
89 x 16931Kb downloads

...detailed information about remote domains, email senders and web site visitors. Alien IP has a clear and...world of today with the large number of site visitors daily, it is sometimes difficult to track...a domain`s location. It allows you to process web logs, ping remote addresses, and trace the route...bog down the user. The detailed world map, toolbar and a status bar are the key elements...
 
searchwebgeolookuphostpositionaddressresolve
Link Validator

Freeware by Oksima team
58 x 228Kb downloads

...and shows report. It very useful and fast tool for those who wants to check all links...
 
check for validitycheck all linksvalidates linksreport
Verification Engine

Freeware by Comodo Inc
82 x 1189Kb downloads

...an innovative, free multi-browser anti-phishing and identity assurance tool to help consumers achieve a new level of...Second, VE can help consumers distinguish between legitimate sites and fraudulent “mimic” sites specifically designed to steal...box is authentic to the brand on the site before they interact with or log-in to their...and protects consumers by enabling them to verify web content before they conduct online business. Once VE...
 
online fraud detactioncontent verificationsite verification

Shareware by Altstone Software
53 x 12473Kb downloads

...Today, businesses are going online. Effective web marketing starts with the thorough analysis of your...potential customers` browsing habits, web site effectiveness monitoring and geo-targeting. Raw web server logs...valuable marketing information. The only question is what tool we use to extract this precious data from...lines of alphanumeric characters, which is what actually web server logs are. The right tool makes the...
 
server logslog analyzerlog analysisweb site statsweb statisticsactivityapachevisitorsweb site analyticstracking
BackLinks Master

Freeware by CleverStat
60 x 1392Kb downloads

...matter how you got inbound links to your site (submitted your site to DMOZ, participated in reciprocal...your resource in a blog), you need a tool to control the status of the links. Do...URLs, submit your target keywords to see linking sites with these keywords in anchor text and so...
 
reciprocal linksbacklinks softwareback link
MySecurityVault

Freeware by WhiteCanyon Inc.
102 x 7629Kb downloads

...stored in your vault. 3. An Internet Explorer Toolbar Plugin: Quickly gain access to personal information stored...in your vault from MySecurityVault`s Microsoft Internet Explorer toolbar plugin. 4. A Secure Site Login Manager: Automatically...log into Internet sites using your personal login data stored in your...to laptop theft. MySecurityVault`s powerful security and encryption tools were previously available only to major Fortune 500...
 
password managermysecurityvaultsecurely lock dataidentity theft preventionpassword protectionencrypt filesfree password manager
CB Bar

Freeware by Clickbank Ebook
59 x 1045Kb downloads

...annoucements of new product additions to Clickbank. Our toolbar is free and contains no spyware or adware...
 
search engineebookssoftwareclickbankaffiliatemarketingtoolbar
DevMansion JavaScript Menu Builder

Freeware by DevMansion
108 x 644Kb downloads

...is a WYSIWYG, lightweight, easy-to-use and easy-to-learn FREEWARE tool focused exclusively on client side JavaScript menus creation....everything you need to create menus for Your site in minutes....
 
buildermenuwizardpopupjavascript
Lucky Downloads search

Freeware by Lucky Downloads
66 x 468Kb downloads

...search query and get results from Lucky Downloads web site. Easy, fast, reliable and free. Does not...
 
freewaresoftwaresharewaredownloadsfind similarluckytoolsearch
EyeOnSite

Freeware by Virdi Software
52 x 824Kb downloads

...EyeOnSite is a tool that keeps an eye on your sites or...Support for http proxy - Support for multi-domained web sites. - No limit to number of sites...
 
httpservicesite-watcherserverssite connectivity monitorsmtppop3ftp
...Great HTML learning tool. Displays formatted HTML as you type so you can instantly see the effect of various HTML tags....
 
web site hostingweb page designweb serverweb serviceweb site designweb site trafficweb page hostingweb hosting servicesweb design freewarehtml toolsfree web hosting