1 2 3 4 5 6 7 8 9 ... 78 79 80 81 82 83 84 85 86 87

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
452 x 1719Kb downloads

Free Vista Files award
...Internet ! The Internet Broadcasting Server is a software package composed of two programs: BS-Server and BS-Tuner....to a potentially large audience, using a standard web server as a bandwidth amplifier. All you need...and the ability to upload files to some web server. BS-Server runs in your computer, builds a...sends this stream into a directory of your web site. The disk space used in the web...
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
Free Download Manager

Freeware by FreeDownloadManager.ORG
1047 x 7039Kb downloads

Free Vista Files award
...world. It lets you download files or whole web sites from any remote server via HTTP, HTTPS,...enhanced audio/video files support, ZIP files preview, browsing web and FTP folders, and more. FDM offers more...version which makes it possible to enjoy the software on every computer without another installation; and its...is the first social download manager inspired by Web 2.0 technologies. It protects you from malicious or...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...Super-fast site log file analysis with SmartDNS lookup. Choose from...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...printing. Gold license adds Scenario Analysis, 17 addl Site Stickiness reports, TreeView Tags, and Report Export capability....Registration.
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
136 x 26624Kb downloads

...high CPU usage, hard disk utilization, device availability, software inventory, etc. ManageEngine OpUtils is available in Free,...tools (Disk Space Monitor, CPU Monitor, Process and Software Scan etc.). The Professional Edition includes all the...trial copy is available for download in the web site. Since it is a web-based product, you...
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...completely new and unique way of updating your web site. Portello is a plug-in to Internet Explorer...to 65 mph! Press the button and your web page as you see it becomes editable, exactly...your changes will be saved instantly to the web server. You can cut, paste, create links and...in other ways edit your web page. You can add, rescale and compress new...and folders between your local drive and the web site like you would with any FTP...
 
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...submission campaign controlled entirely by you not the software The webmasters tool will only pre-populate web pages...submit keeping you in control. Comprehensives list of sites to post to including over 160 RSS, PAD,...Blogg, Podcast, Shareware and Freeware sites. With the webmasters tool you will never waste time and money...on targeting the wrong keywords again. The webmasters tool is able to check MSN, Yahoo and...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
GooPR

Freeware by TM Services
61 x 0Kb downloads

...Put the web address into the field, press Enter, get Google...you will get the Google pagerank value and web site position in Google directory. It`s very convenient...of Delphi you may order this through Plimus software registration service....
 
relevancepositiongoogle directorysearch engineseooptimizationanalyzepagerank
CiDess

Freeware by CiDess
96 x 3158Kb downloads

...extra data in a PCB file - Automatic web page generation to publish your PCB - Support...change language during program execution - A free software is available to translate CiDess in any language,...format description in the coders section of this web site - 100% free - Can run on...
 
layouteditorpcbfree
Idaho-Web-Counter

Freeware by Implied By Design
99 x 248Kb downloads

...simple way to add cool counters to your web site. Just click on the counter style you...to your clipboard. Paste the code into your web page and you`re done! Idaho-Web-Counter allows you to...want, there`s no limit! It`s called the "Idaho" web counter because there are number of Idaho-inspired counter...
 
web page designweb design freewarewebsite designhtml designhtml toolsweb toolsfree web softwareidaho web counter
Photo Resize Magic

Freeware by SOW
379 x 582Kb downloads

...easy-to-use tool for digital camera owners. This free software allows you to resize and convert your digital...to your friends by e-mail, upload to a web site, etc. Add some visual effects to your...
 
convertdigital photojpegtiffjpgconversionphoto resizer
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great...websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...new best friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
smc WebStore Free

Freeware by smc technologies, Inc
94 x 4146Kb downloads

...no advertisements, no contracts, no hosting plans or software to buy. Sell up to 10 products from...in checkout area and administration screens for our web based edition. Capability to link to products and...
 
e-commerceecommercestorefrontshopping cartsshopping cart programsebusiness softwareshopping cart softwareeasy shopping carte-business softwareshopping cart systems
Alien IP

Shareware by ArmCode
89 x 16931Kb downloads

...Alien IP is trace routing software that resolves domain names, pings IP addresses, and...detailed information about remote domains, email senders and web site visitors. Alien IP has a clear and...world of today with the large number of site visitors daily, it is sometimes difficult to track...a domain`s location. It allows you to process web logs, ping remote addresses, and trace the route...
 
searchwebgeolookuphostpositionaddressresolve
AlterWind Log Analyzer Lite

Freeware by AlterWind Software
66 x 2271Kb downloads

...AlterWind Log Analyzer Lite is free web log analysis software. It quickly generates all traditional...reports. Use this user-friendly software to grab web server logs (all formats supported) and build graphically-rich...self-explanatory reports on web site usage statistics, referring sites, traffic flow, search phrases...help you to estimate the auditory of your site and increase website traffic. You will get all...
 
alterwindsample reportwebsite statisticsloganalyzerconfiguration stringserver logssite mirrorslog analyzerapachelog analysislog files any format
Audio Video IFilter

Freeware by AimingTech Company
75 x 325Kb downloads

...the MP3 files. Audio Video IFilter is a software component that provides benefits together with other Windows...SharePoint Portal the IFilter lets you provide your site or portal visitors with a powerful search of...
 
ifiltersearchindexingsharepointmp3desktopwmaservicewmv
iNetFormFiller Free

Freeware by iNetFormFiller
56 x 3487Kb downloads

...mind passwords and wasting your time filling countless web forms? Get rid of this inconvenience. Just put...future. iNetFormFiller provides you with opportunity to edit web forms without loading them from the Net. When...same way it was display on the corresponding web site. The process of editing would be obvious...
 
online form toolsweb form fillerpassword keeperpassword manager
LinkSpirit

Freeware by Zapman
52 x 887Kb downloads

...PageRank of your pages is one of the main factor that decide of their positions in the results of search engines. It is calculated according to the number of external...
 
pageranklinkanalyserinternal
Senomix Timesheets

Commercial by Senomix Software Inc
61 x 59000Kb downloads

Free Vista Files award
...Senomix Timesheets is the easiest networked time tracking software for engineering and project-based offices. Providing a web...timesheet without requiring a web browser, Senomix Timesheets delivers an easy way to...are located in one building or at many sites around the world. Senomix`s stopwatch and user interface...serial number via our keygen, please visit our web site at www.senomix.com...
 
time trackingtimesheet trackingtimesheets softwareweb timesheetweb time trackertimesheet softwaretime sheettime tracking softwarequickbookstime sheet software

Shareware by Altstone Software
53 x 12473Kb downloads

...Today, businesses are going online. Effective web marketing starts with the thorough analysis of your...potential customers` browsing habits, web site effectiveness monitoring and geo-targeting. Raw web server logs...lines of alphanumeric characters, which is what actually web server logs are. The right tool makes the...Geo Log Analyzer by Altstone Software, a unique web server log analyzer capable of representing geographical stats...
 
server logslog analyzerlog analysisweb site statsweb statisticsactivityapachevisitorsweb site analyticstracking
BackLinks Master

Freeware by CleverStat
60 x 1392Kb downloads

...matter how you got inbound links to your site (submitted your site to DMOZ, participated in reciprocal...URLs, submit your target keywords to see linking sites with these keywords in anchor text and so...
 
reciprocal linksbacklinks softwareback link