Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
452 x 1719Kb downloads

Free Vista Files award
...photos over the Internet ! The Internet Broadcasting Server is a software package composed of two programs:...to a potentially large audience, using a standard web server as a bandwidth amplifier. All you need to...and the ability to upload files to some web server. BS-Server runs in your computer, builds a...sends this stream into a directory of your web site. The disk space used in the web...
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
XP Lan Pro

Freeware by Apnasoft Technologies
220 x 2021Kb downloads

...Feathers : These are overall features of XP Lan Pro 3.3 (Beta). XP Lan Pro 3.3 (Beta) can determine following things. IP address of your computer, MAC address of...
 
network informationxplanpro
Scannet Pro

Shareware by Profiler3d
294 x 11118Kb downloads

...of connections over a number of individual WHOIS servers including the X500 NASA server.The HTTP module offers...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook

Freeware by Adiscon GmbH
78 x 100Kb downloads

...Adiscon logger is an UNIX-like logger command line tool for Windows. It is a re-write of the UNIX logger tool with enhanced functionality. All the popular UNIX options...
 
syslogwindowsunixlinuxcommand linelogger

Freeware by VitalTech Group
199 x 756Kb downloads

...VitalTech IPCalculator is an easy-to-use IP subnet calculator that lets you to calculate every aspect of your subnet configuration in a few mouse clicks. It takes an IP...
 
networkmaskbitsubnetserversolvecalculator
SPAM Shredder

Freeware by Safe Soft Corporation
110 x 1269Kb downloads

...you remove spam emails just from the mail server without pulling them down into your Inbox. SPAM...
 
clientencryptsecuritye-mailsafepublic keyexpressemailspamprotect
Paessler URL Recorder

Freeware by Paessler AG
91 x 740Kb downloads

...POSTDATA strings that a user sends to a web server while surfing a sequence of URLs. It works...like a standard web browser, whereby you enter a URL at the...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Free Download Manager

Freeware by FreeDownloadManager.ORG
1047 x 7039Kb downloads

Free Vista Files award
...world. It lets you download files or whole web sites from any remote server via HTTP, HTTPS,...enhanced audio/video files support, ZIP files preview, browsing web and FTP folders, and more. FDM offers more...is the first social download manager inspired by Web 2.0 technologies. It protects you from malicious or...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...SQLWriter is a powerful SQL script editor for all database developers and database administrators. It supports ACCESS, SQL SERVER, ORACLE, DB2, SYBASE, MYSQL, FIREBIRD and others. In addition, it also...
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...that lets you get the feel of your website traffic. See volume of traffic from page to...your Windows desktop rather than slowing down your web server. It can analyze log files from virtually...
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
Time Zones Clock

Freeware by Galleon Systems Ltd
177 x 362Kb downloads

...Running on your PC Time Zone Clock will show you the local time of over 300 cities around the world. Simply select the cities you want to display the local...
 
rugby time serverclocktime zonesntp time serveratomic clock
LCP

Freeware by LCPSoft
235 x 2340Kb downloads

...Password auditing and recovery tool for Windows NT/2000/XP/2003. Accounts information import: import from local computer, import from remote computer, import from SAM file, import from .LC file,...
 
securityrecoverysyskeyadministratorpasswordssystemauditwindows
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP...relay server and scans your incoming and/or outgoing mail for...set up multiple profiles for POP and SMTP servers and switch between them from the system tray....
 
internetutilitiesmail headermail headers
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
136 x 26624Kb downloads

...(Bandwidth Monitor, Network Monitor, Wake-on-LAN, Port Scanner,etc.) and Server monitoring tools (Disk Space Monitor, CPU Monitor, Process...trial copy is available for download in the web site. Since it is a web-based product, you...
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools

Freeware by Carson E. White
147 x 26119Kb downloads

...genealogy software for building family tree s using a skeleton model starting at the current century backwards to AD or beyond. Includes charts and Grids that are all printable. And...
 
genealogytreedatabasesoftwarefamily
ManageEngine Applications Manager

Freeware by ZOHO Corp.
106 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...Manager proactively monitors applications and servers and notifies problems in network through e-mail/SMS. It...higher availability and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
InstantCharts Messenger for Traders

Freeware by ASSISTANCE LLC.
82 x 2082Kb downloads

...InstantCharts Instant Messenger for Traders, this free software gives you an access to market data which is represented by tickers, quote lists, news and charts. A very useful tool for...
 
quotejavajabberstocknysemsnyahoomessengerchartsxmppicqinstant
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...completely new and unique way of updating your web site. Portello is a plug-in to Internet Explorer...to 65 mph! Press the button and your web page as you see it becomes editable, exactly...your changes will be saved instantly to the web server. You can cut, paste, create links and...in other ways edit your web page. You can add, rescale and compress new...and folders between your local drive and the web site like you would with any FTP client....
 
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing