Sort by : ReleasedNameDownloadsAddedRatingRelevance
Mp3search

Freeware by Mp3 software
350 x 292Kb downloads

...Mp3 search is an easy to use and fast program...on the Internet. It uses the best MP3 search engines available on the Internet today. It not...the music you want, it also verifies the search results, so you`ll be sure you can download...downloads. Because the music files come from ordinary Web sites nobody is peeking on your hard drive...most recent version has an updated set of search engines. The play list now has a better...
 
mp3 searchmp3 songsmp3 filesfree mp3 musicmp3 softwarefree mp3 download
FastStats Analyzer Free

Freeware by Mach5 Development
91 x 2851Kb downloads

Free Vista Files award
...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...Bandwidth, Search Keywords and Phrases, Referrers, Visitors per day, Most...that lets you get the feel of your website traffic. See volume of traffic from page to...your Windows desktop rather than slowing down your web server.
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
...of eBay(R) to your living room. You can search for items, browse in the eBay categories or...get notified of ending auctions and outbids. This software has won the "eBay Star Developer Award for...completely free to use. Donations are welcome (see website for details)....
 
bidmedia centerbuyauction
Job Seek Manager

Freeware by Z5Com Pty Ltd
97 x 65Kb downloads

...very simple you select a job from the Web and copy and paste data into this software....
 
apply job softwareapply work softwareapply contract softwareseek job softwarefind job softwareseek contract softwarefind contract softwarejob application softwarejob search software
Sponsored Ad Blocker

Freeware by SuperAdBlocker.com
78 x 3193Kb downloads

...Sponsored Ad Blocker™ protects the relevance of web searches by blocking often misleading and annoying sponsored search...Google, MSN, AOL, Yahoo and over 20 other search engines and web-sites. This software is NOT ad...
 
browser extensionblockersearch
PicaJet Photo Organizer

Freeware by PicaJet.com
161 x 5064Kb downloads

Free Vista Files award
...any category using intuitive visual cues. PicaJet`s powerful search function makes locating a group of photos or...
 
photo organizerphoto organizingphoto gallery softwarephoto management softwarephoto album softwarecataloging tool
i-Covers

Freeware by Synops.biz
106 x 1384Kb downloads

Free Vista Files award
...i-Covers is a free search engine for movie covers on the Internet. The...
 
cinemadvdmoviesoftwarefreewarejacketvideocoverposterdivx
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...submission campaign controlled entirely by you not the software The webmasters tool will only pre-populate web pages...Blogg, Podcast, Shareware and Freeware sites. With the webmasters tool you will never waste time and money...on targeting the wrong keywords again. The webmasters tool is able to check MSN, Yahoo and...return a ranking based upon a percentage of searches estimated by Overtures keyword suggestion tool. Automation The...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
GooPR

Freeware by TM Services
61 x 0Kb downloads

...Put the web address into the field, press Enter, get Google...you will get the Google pagerank value and web site position in Google directory. It`s very convenient...of Delphi you may order this through Plimus software registration service....
 
relevancepositiongoogle directorysearch engineseooptimizationanalyzepagerank
CiDess

Freeware by CiDess
96 x 3158Kb downloads

...as 3DG file - Featured file manager with search engine, find and sort easily your PCB files...extra data in a PCB file - Automatic web page generation to publish your PCB - Support...change language during program execution - A free software is available to translate CiDess in any language,...format description in the coders section of this web site - 100% free - Can run on...
 
layouteditorpcbfree
CookDojo Home Edition

Freeware by Cookdojo.com
121 x 164Kb downloads

...COOKDOJO HOME EDITION - Web Based Version - Recipe Management Software - ver...1.12. Web based recipe managemet. This software enables you to manage all your recipes with...ease. Adding, editing, printing and searching for recipes is simple and fast. You can...make your own ebook. Features : Web Based; Add / Remove Recipe Category; Add /...Remove Recipe in Category; Search recipe in title, ingredient, method; Export to E-book...
 
webbasedsoftwarerecipemanagement
...you seamless access to a calculator, text-to-speech reader, Web search results and any of your notes quickly,...up to any drive, and it lets you search by date, title, content, or partial character strings....HTML, so you can post them in a web server, import notes, and change to different colorful...
 
free softwarefreewareipodpimsresearchnote takerfree skinsarchiveaddress booknoteitorganizercalculatorreadernotestext-to-speechapple
...is an incredibly fast and easy to use software that uses multiple search engines to search a...myriad of web sites simultaneously for a more comprehensive Internet experience....wonderful way for you and your family to search the web for school, work, or just for...fun. * Search multiple engines all at once. - Use more...than one search engine to get more comprehensive search results.
 
websearchinternetnewssearchfirststopenginemetasearch
Free Hex Editor

Freeware by HHD Software
497 x 2072Kb downloads

...Free Hex Editor Software - Binary and Hex file editing tool for...Windows with Multi-Window, Multi-Document Interface, Text Viewer, Advanced Search and Replace features. Edit your Exe Code, Hex...
 
codesoftwarefreeviewerwindowsreadertextdumpsfreewarehex dumpfileeditingbinhexeditor
Media Catalog Studio Lite

Freeware by ManiacTools
183 x 2926Kb downloads

Free Vista Files award
...this problem with Media Catalog Studio, a handy software application for classifying and tracking media files. This...frequency, genre, category, rating or any field/category. The search in the database can be conducted using multiple...
 
wma tag editorcollection managervideo managerid3 tag editoroggmovies organizeraudiomp3 taggervideo organizermusic organizerwmvcddbmpegmedia organizerpalylist managermp3 organizermp3 managerape
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...CoffeeCup HTML Editor: Advanced web design for everyone. You want to create great...websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...stay on top of the latest and greatest web design developments, we have four words: HTML5 and...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
...CatalogBuilder is multimedia CD brochure making software for both business as well personal album. A...catalog can be easily distributed / displayed as web gallery, web catalog, photo album, multimedia CD brochure...or electronic catalog. Unlike most photo album software or photo gallery creators, CatalogBuilder gives typical edge...campaign. User need not to depend upon external web designers & catalog service providers for frequent catalog...
 
free slide show builderfree catalog builderfree catalog softwarefree photo album softwarefree web catalog makerfree catalog maker
Alien IP

Shareware by ArmCode
89 x 16931Kb downloads

...Alien IP is trace routing software that resolves domain names, pings IP addresses, and...detailed information about remote domains, email senders and web site visitors. Alien IP has a clear and...a domain`s location. It allows you to process web logs, ping remote addresses, and trace the route...
 
searchwebgeolookuphostpositionaddressresolve
100Share.com Lyrics Base

Freeware by 100share.com
217 x 4943Kb downloads

...your favorite lyrics through this free utility. This software lists all the artist by A-Z order, and...file from Internet directly. Other features include local search support and an Internet search assistant for lyrics...
 
security cameralyrics
AlterWind Log Analyzer Lite

Freeware by AlterWind Software
66 x 2271Kb downloads

...AlterWind Log Analyzer Lite is free web log analysis software. It quickly generates all traditional...reports. Use this user-friendly software to grab web server logs (all formats supported) and build graphically-rich...self-explanatory reports on web site usage statistics, referring sites, traffic flow, search...much more! AlterWind Log Analyzer Lite supports 430+ search engines from 120 different countries. Reports generated by...
 
alterwindsample reportwebsite statisticsloganalyzerconfiguration stringserver logssite mirrorslog analyzerapachelog analysislog files any format