Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
...What is the need for encrypting email messages you might ask yourself? But if any...a powerful, highly configurable, yet easy to use email client. It is also a public key email...automatically encrypts all your messages and an anti-spam email client that automatically classifies incoming emails as do any additional operations to make your email secure. It also supports drag and drop attachments,...
spamsecuritysafeemailclientexpressprotectpublic keyencrypte-mail
SPAM Shredder

Freeware by Safe Soft Corporation
110 x 1269Kb downloads

...SPAM Shredder is an anti-spam email client that automatically classifies incoming emails as spam...spam filtering software that lets you remove spam emails just from the mail server without pulling them...emails. SPAM Shredder is a powerful and comfortable email client with effective spam filtering and good privacy...
clientencryptsecuritye-mailsafepublic keyexpressemailspamprotect
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award but elegant tool to help you with mailing list management. This very small program is easy...runs in the background. It can check your mailbox and parse through messages looking for delivery failures,...a date and a label indicating why the email was added for auditing purposes. You can optionally...message for deletion after processing, and leave unmatched email in your mailbox to check personally. As part...
Mach5 Mailer

Freeware by Mach5 Development
114 x 9854Kb downloads

Free Vista Files award
...of email! Simple, Free, and Effective. Send personalized email messages to customers, from any database source including...TLS/SSL encryption, Port changing allows use on all mail servers. Great for newsletters and announcements! Schedule multi threaded delivery, then process the return email with ease. Your contacts get a personal message...and plain text messages, and HTML Import from web greatly simplifies sending HTML messages.
m9P Zipper

Freeware by mental9Production
160 x 2037Kb downloads

...m9P Zipper is a file compression (zipping) and decompression (unzipping) utility. This tool, capable of up to 0.9 compression ratio, outputs a zipped file that is a mere shadow...
5pSoft Clock

Freeware by 5pSoft inc
98 x 433Kb downloads

...Here`s a free timer utility program that offers a novel and interesting way of presenting the current time on your Windows desktop. This is a freeware. It works with...

Freeware by SMSCOUNTRY
394 x 2744Kb downloads

...You can send sms from Microsoft® Outlook® and it is as simple as sending an email. Keep in touch with customers, staff or colleagues with this SMS add-in for...
email smsmobilesms toolsbulk smssms softwaresms from outlookfree sms
...and log network activity of the any applications(browsers, email clients etc.). So what does that mean in...
...X-Ray is an email header filter and POP/SMTP server switching tool. It...relay server and scans your incoming and/or outgoing mail for user specified mail headers. Once it finds...
internetutilitiesmail headermail headers
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...Monitoring, Oracle Application Server, JBoss Monitoring, Tomcat Monitoring, WebLogic Monitoring, WebLogic Integration Monitoring, WebSphere Monitoring, J2EE Web...performance can be monitored by the SAP Module. Website monitoring involves URL Monitoring , URL Sequence Monitoring,...
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...e-mail spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows...wish to provide yourself. Traffic limiting protects your mail service from flooding or directory harvest attacks. Recipient...submitted, avoiding the backscatter problem caused by some mail servers trying to send non-delivery notifcations to forged...
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
590 x 14208Kb downloads

Free Vista Files award
...server program for Windows that lets you send email messages directly from your computer to recipient mailboxes....Along with a mass mailer the program can be used as a relay...server for sending newsletters, distributing messages to different mailing lists, sending notifications to your customers, as an privacy. Advanced SMTP Server supports all email programs like Outlook Express, Outlook, Eudora, etc. The...
Free Vista Files award
...R-Firewall is an effective and easy-to-use solution to secure your on-line activity. It protects a computer connected to a local network and/or to the Internet...
data protectionfirewallonline securitydata securityon-line security
RapidSMTP Free Edition

Freeware by
72 x 10904Kb downloads

Free Vista Files award
...Android..) or users, who have not visited your website for a defined time span. You can use...
GroupMail :: Free Edition

Freeware by Infacta Ltd
107 x 13299Kb downloads

Free Vista Files award
...This group email software and marketing solution takes the time and...effort out of sending email newsletters, announcing new products or services to your...customers or running an email marketing campaign. GroupMail puts you in full control of your email...with family and friends. With highly personalized messages, GroupMail Free Edition makes communicating with large lists of...
bulk mailerfree html email templatesnewsletter softwarefree group email softwaregroup maillist management softwaregroupmailbulk email softwareemail marketing softwareemail newslettersmass email software
Random Signature Changer

Freeware by den fete gjengen
65 x 230Kb downloads

...RSC helps you change your mail signature. All you have to do is set...x minutes. This program should work with most email clients, as long as the client supports reading...

Freeware by Comodo Inc
93 x 10370Kb downloads

...product that eliminates spam forever from the computer`s email system. No license fees - No charges -...Elimination - never wade through mountains of junk mail again - No hassle set-up - install in...seconds for instant spam free email - Maximum Protection - Minimum Drain - kills...
free antispam toolfree antispam softwaredesktop antispam toolantispam free download
M8 Free Multi Clipboard

Freeware by M8 Software(UK)
106 x 7006Kb downloads

...CLIPS - M8 is the simplest of all multi-clipboard and screen capture programs. Just have it running minimized and it captures everything you cut or copy from other programs. It...
multiclipboardscreen capturemulti-clipboardscreenshotscreen shotmulti clipboard
...abcAVI Tag Editor is little stand alone utility for viewing/editing tags in AVI files. In short it allows you to get information on movie from Internet Movie Database or...
copyrightfourcc changercatalogtitlesearchdecoderauthoringmeta tagsvideo and audiocodecencodertags editordivx