1 2 3 4 5 6 7 8 9 ... 51 52 53 54 55 56 57 58 59 60

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
SPAM Shredder

Freeware by Safe Soft Corporation
110 x 1269Kb downloads

...SPAM Shredder is an anti-spam email client that automatically classifies incoming emails as spam...spam filtering software that lets you remove spam emails just from the mail server without pulling them...emails. SPAM Shredder is a powerful and comfortable email client with effective spam filtering and good privacy...
 
clientencryptsecuritye-mailsafepublic keyexpressemailspamprotect
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...free but elegant tool to help you with mailing list management. This very small program is easy...up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...can check your mailbox and parse through messages looking for delivery failures,...a date and a label indicating why the email was added for auditing purposes. You can optionally...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP...relay server and scans your incoming and/or outgoing mail for user specified mail headers. Once it finds...set up multiple profiles for POP and SMTP servers and switch between them from the system tray....
 
internetutilitiesmail headermail headers
ManageEngine Applications Manager

Freeware by ZOHO Corp.
106 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...Manager proactively monitors applications and servers and notifies problems in network through e-mail/SMS. It...higher availability and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
120 x 15516Kb downloads

Free Vista Files award
...e-mail spam filter (SMTP/POP3) compatible to every known mail server software. The flexible filter pipeline architecture allows...wish to provide yourself. Traffic limiting protects your mail service from flooding or directory harvest attacks. Recipient...submitted, avoiding the backscatter problem caused by some mail servers trying to send non-delivery notifcations to forged...
 
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server
Advanced SMTP Server

Shareware by IM-Soft
563 x 14208Kb downloads

Free Vista Files award
...Advanced SMTP Server is a system-tray local SMTP server program for Windows that lets you send email...computer to recipient mailboxes. Along with a mass mailer the program can be used as a relay...server for sending newsletters, distributing messages to different mailing lists, sending notifications to your customers, as well...can use it instead of your ISP`s SMTP server to increase your security an privacy. Advanced SMTP...
 
smtpmailfreemailingbookemailmassaddressmailere-mailbulkremailerbomber
RapidSMTP Free Edition

Freeware by RapidSMTP.com
72 x 10904Kb downloads

Free Vista Files award
...Android..) or users, who have not visited your website for a defined time span. You can use...
 
mailingnewslettersgeolocationmailinglistemailmysqlmarketingsendbulkemails
Free SMTP Server

Freeware by IM-Soft
305 x 619Kb downloads

Free Vista Files award
...Free SMTP Server is a SMTP server program for Windows that lets you send email...You can use it instead of ISP`s SMTP server to increase your security and privacy. Free SMTP...Server supports all email programs like Outlook Express and Eudora, but best...optimized to work with Outlook Express. The email program you already use for sending and receiving...messages can be connected to the server in a very easy way - by using...
 
bombersmtpfreemailerbookemailbulkaddressremailermasse-mailmailing
1st SMTP Server

Freeware by Emailarms
130 x 14208Kb downloads

Free Vista Files award
...1st SMTP Server - a free SMTP relay server- is a...simplest, easy to use SMTP mail relay server. It is used for relaying your...Whenever you need to send large amounts of email from a mass mailing program like Advanced Emailer...You can install several servers like this one on different computers to minimize...
 
emailpopremailermailinge-mailmasssmtpbulk
...Allows to delete the selected e-mails on the server side. - Can download complete selected message, but...when you are accessing your e -mail via web interface only....
 
spame-mailpop3spam filterantispam
SpamAware

Freeware by JAM Software GmbH
58 x 14619Kb downloads

Free Vista Files award
...Everyone owning an email address knows these annoying mails you receive. The number of spam mails running...to spend more time on sorting out good mails from spam. Don`t waste time on this let...a plugin for MS-Outlook, Outlook Express and Windows Mail (Vista). It uses SpamAssassin to score new incoming...all your Outlook contacts and add recipients of mails you write to the Whitelist....
 
filterspamassassinoutlook expresse-mailspamawareantivirusmore spamplugin
Pivo Email Validator Component

Freeware by Pivo Corporation
110 x 232Kb downloads

...Having problems with the email addresses in your mailing list?Are you tired of getting bounce backs every...time you perform a mailing? Email Validator will solve your email validation problems. Email...framework to run. It is used to validate email addresses at different levels. Email Validator does not...have a GUI front end, it is a server component that can only be accessed programmatically. Email...
 
asp componentserver componentasp net componentemail validator
Pivo pop3 Component

Freeware by Pivo Corporation
92 x 232Kb downloads

...ASP.NET or other COM environment applications to retrieve email from mail server based on POP3 protocol. Pivo...It also provides advanced features such as retrieve emails in background, capability of unlimited queued request. POP3...is a widely-deployed mail access protocol. Many programs access POP3 message stores,...a single string representation is convenient. A POP3 mailbox (like an [IMAP4] mailbox) is a network resource,...
 
email addressasp componentemail parserserver componentpop3asp net component
Pivo DnsResolver Component

Freeware by Pivo Corporation
56 x 232Kb downloads

...Dns Resolver is used to queries DNS servers for host information and programmatically query DNS servers...DNS record lookups.It can be used from ASP.NET web pages, to windows forms, to web services. The...address for each host name, and lists the mail exchange servers accepting e-mail for each domain. The...
 
ptrdns recordsasp componentlookupserver componentreversesoaasp net componentzones
Pivo SMTP Component

Freeware by Pivo Corporation
101 x 810Kb downloads

...Short for Simple Mail Transfer Protocol, a protocol for sending e-mail messages...between servers. Most e-mail systems that send mail over the Internet use SMTP to send messages...from one server to another; the messages can then be retrieved...is generally used to send messages from a mail client to a mail server. This is why...need to specify both the POP or IMAP server and the SMTP server when you configure your..
 
server componentasp componentasp net componentemail parsersmtpemail addresspop3ping
AzDGDatingLite

Freeware by AzDG
108 x 794Kb downloads

Free Vista Files award
...Free dating script working on PHP and MySQL. Multilanguage, Multitemplate, 35 registration fields, 3 photos, quick/simple search, feedback with webmaster, Admin maillist, Photo of the day, who is online,...
 
portalmysqltutorialsoftwarematchmakerphpnukeprogrammerservertemplateamoreprojectuploadwindowscriptforumsourcesessionmaildatingfriendonlinepersonalsmanualwebfreemeetprogrammingtheme
Rapid-Emailer

Freeware by Absolute Futurity
75 x 3912Kb downloads

...Fast email campaign manager. Anonymous Emailer with a Built-In SMTP Server. Duplicate address removal,...you to put each user info in each email automatically, command Line support. pure header manipulation, very...large email list support, overload protection, creates a failed and...the same email.. Command Line support for sending Email Campaigns. Supports Embedded images. Multiple threads, sending up...
 
internet marketingbulk mail softwarepure header manipulationanonymousbuilt-in smtp serverbulk emailerprospect maileremail marketingemail campaign managerfast e-mailercontact managermass emailer
Perfect Emailer

Shareware by E-Mail-Soft
23 x 9216Kb downloads

...Perfect Emailer is a professional high performance mass mailing management and sending software for targeted bulk email...marketing campaigns and email lists building at your desktop. With Perfect Emailer,...You can easily manage mass mailing lists for your subscribers, create high personalized HTM...connection. The program has its own internal SMTP server and delivers email messages directly to their recipients...
 
mailing softwaremass mailerbulk mailerperfect mailer

Freeware by Rugila Software
43 x 19Kb downloads

...If you cannot read mail or use other Internet services due to firewall...
 
connectionredirectortcpipsocks