Sort by : ReleasedNameDownloadsAddedRatingRelevance
Net Blitz

Freeware by Emparch
162 x 1312Kb downloads

...program to play Chess or Bughouse over the Internet or local network. Net Blitz II now includes...
 
networkfreedoublechessonlinegamemultiplayerbughouse
I of the Enemy: Ril`Cerat

Freeware by Enemy Technology
360 x 68891Kb downloads

...I of the Enemy: Ril`Cerat is a totally free, stand alone, science fiction real-time starategy game, that is the first chapter in the "I of the Enemy" saga....
 
the enemyreal time strategysingle-playervideo gamesenemy technologymulti-playerlaninternetsci-fi
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
452 x 1719Kb downloads

Free Vista Files award
...live audio, MP3 music and photos over the Internet ! The Internet Broadcasting Server is a software...to a potentially large audience, using a standard web server as a bandwidth amplifier. All you need...to start your own Internet broadcast is this program, and the ability to...upload files to some web server. BS-Server runs in your computer, builds a...sends this stream into a directory of your web site. The disk space used in the web...
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
Advanced Security Tool - AST

Freeware by PatilanSoft
134 x 4000Kb downloads

...are encrypted. Auto fill login and passwords in Internet Explorer. BOOKMARKS MANAGER: Import Favorites from Internet Explorer,Mozilla...prevent your passwords from theft. Integrated into Microsoft Internet Explorer. XP interface....
 
explorerciphersecretkeyloggerfillloginsmanagerpadgeneratorinternetpasswordbookmarksnote-bookautoencrypted
Mp3search

Freeware by Mp3 software
350 x 292Kb downloads

...the best MP3 search engines available on the Internet today. It not only finds the music you...downloads. Because the music files come from ordinary Web sites nobody is peeking on your hard drive...
 
mp3 searchmp3 songsmp3 filesfree mp3 musicmp3 softwarefree mp3 download
Scannet Pro

Shareware by Profiler3d
294 x 11118Kb downloads

...Network Monitor,Intern Firewall.Trace route,Shows release,Lists devices and network services,observing network release,observing all ports,direct access on all network releases in LAN,WAN and Internet....
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
AntiSpye

Freeware by ZERGE.COM
121 x 384Kb downloads

...There are lot of software that fights against viruses and spy modules which are doing attacks to your PC from Internet. However, there are some times when a spy may...
 
screenshot takerantispyesoftwarehidefreewaremouseblank screen
Konst Pinger

Freeware by VisualSoft
213 x 1015Kb downloads

...Pinger is a program for ping and trace internet host. Ping host that you choice. Show results...
 
internettracepingwhoishost
Paessler URL Recorder

Freeware by Paessler AG
91 x 740Kb downloads

...POSTDATA strings that a user sends to a web server while surfing a sequence of URLs. It...works like a standard web browser, whereby you enter a URL at the...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Free Download Manager

Freeware by FreeDownloadManager.ORG
1047 x 7039Kb downloads

Free Vista Files award
...world. It lets you download files or whole web sites from any remote server via HTTP, HTTPS,...enhanced audio/video files support, ZIP files preview, browsing web and FTP folders, and more. FDM offers more...is the first social download manager inspired by Web 2.0 technologies. It protects you from malicious or...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
Mach5 Mailer

Freeware by Mach5 Development
114 x 9854Kb downloads

Free Vista Files award
...and plain text messages, and HTML Import from web greatly simplifies sending HTML messages. Attachments are automatically...that supports this common standard. Even over the internet or across your LAN. Note. Mailer is not...
 
sqle-mailphpmergeattachmentsinfactajavascriptmicrosoftcsvbulkvisualwindowsnewslettermailingsodbcopt-inlisthtmlnotificationworldmailvistaexcelsoftwaremassemailerdatabasecustomizemarketingaccess
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...that lets you get the feel of your website traffic. See volume of traffic from page to...your Windows desktop rather than slowing down your web server. It can analyze log files from virtually...
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
XSite

Freeware by Veign
82 x 1705Kb downloads

...XSite will load and parse any webpage into a simple structured view for displaying images,...email addresses. Easily grab all images in a web page by downloading them to a local folder....Get all emails, links, and images from any web page - Download images to a local folder...
 
extractemail addressesinternetwebpageimages
...reduces the amount of incoming traffic and a web page loading time by blocking the most annoying...installed on your computer while you surf the Internet from advertisement ads. VAB blocks video and flashing...
 
interactive videofull-screen with video adsvideo pop-up stoperstop flashvideo pop blockthe video commercialflash animation stoppervideo pop killervideo popup blockstop video popupblock flashvideo popup stopper
Car Logbook

Freeware by Z5Com Pty Ltd
90 x 78Kb downloads

...Car Logbook is an applet designed to track the business use of vehicles. It supports multiple vehicles and...
 
car usagevehicle usagevatcar logbookvehicle mileagetaxvehicle kilometersvehicle logbookcar kilometerscar mileagecar travelato
Job Seek Manager

Freeware by Z5Com Pty Ltd
97 x 65Kb downloads

...very simple you select a job from the Web and copy and paste data into this software....
 
apply job softwareapply work softwareapply contract softwareseek job softwarefind job softwareseek contract softwarefind contract softwarejob application softwarejob search software
...(send mail), NNTP (newsgroups)! It works great with Internet Explorer, Firefox, Outlook, and many more!...
 
proxylogtunnel
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP relay server and scans your incoming and/or outgoing mail...
 
internetutilitiesmail headermail headers

Freeware by Carson E. White
147 x 26119Kb downloads

...Grids that are all printable. And a free internet version family tree builder at www.winloft.com. Includes conversions...
 
genealogytreedatabasesoftwarefamily