1 2 3 4 5 6 7 8 9 ... 92 93 94 95 96 97 98 99 100 101

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
447 x 1719Kb downloads

Free Vista Files award
...to a potentially large audience, using a standard web server as a bandwidth amplifier. All you need...and the ability to upload files to some web server. BS-Server runs in your computer, builds a...audio files, and sends this stream into a directory of your web site. The disk space used...in the web server is always less than 5 MB, even...your broadcast by setting user-based passwords with your web server htaccess files....
Software602 Groupware Server

Shareware by Software602, Inc.
107 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook

Freeware by Safe Soft Corporation
127 x 439Kb downloads

...decrypt files of every type and even whole directory structures. For this it uses strong encryption, encryption...
securitytoolsfilesfolderssoftwarechaospasswordshreddersourceprogramsblowfishprotectingcompressrandomsafetydocumentsencryption systemnumbercryptographic algorithmsgeneratorcode
m9P Zipper

Freeware by mental9Production
159 x 2037Kb downloads

...files and not complete directories. However, a zipped directory containing many files can be unzipped using m9P...

Freeware by Z5Com Pty Ltd
146 x 68Kb downloads

...YourDir is used to print windows directories or folders. It can also create Jpeg file of a Windows...
print treeprint pathsprint foldersprint folder structureprint directory structure
ManageEngine Applications Manager

Freeware by ZOHO Corp.
100 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...Monitoring, Oracle Application Server, JBoss Monitoring, Tomcat Monitoring, WebLogic Monitoring, WebLogic Integration Monitoring, WebSphere Monitoring, J2EE Web...performance can be monitored by the SAP Module. Website monitoring involves URL Monitoring , URL Sequence Monitoring,...
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
ID3 renamer

Freeware by x2develop.com
339 x 87Kb downloads

Free Vista Files award
...rename a large number of files in a directory accordingly to their ID3 description and a given...you have loads of MP3 files in a directory and need to write a single common piece...
tagtaggerid3id3 taggeraudio toolfolderbitrateid3 renamertaggingfreedbedit id3 tagscddbid3v2mp3id3v1tag editorbatchfile renamerename mp3id3 tag editorfile renameralbummusic
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
110 x 15516Kb downloads

Free Vista Files award
...limiting protects your mail service from flooding or directory harvest attacks. Recipient addresses can be checked while...statistics charts and reports in real-time using a web browser, or using the NoSpamToday admin application. Data...
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server

Freeware by TM Services
58 x 0Kb downloads

...Put the web address into the field, press Enter, get Google...you will get the Google pagerank value and web site position in Google directory. It`s very convenient...
relevancepositiongoogle directorysearch engineseooptimizationanalyzepagerank

Freeware by Lars Werner
126 x 1333Kb downloads

...Some critical bugs fixed SizeMe scans a selected directory for the size of each item. Then it...info: SizeMe makes it possible to scan a directory and compare it to how many floppy/zip/CD-R/DVD-discs you...maximum output Information about usage Right click a directory anywhere in Explorer, and press "Find sizes with...against. If the directory/file is marked RED the directory does not fit on the given media size....
ManageEngine OpManager

Freeeware by AdventNet Inc
123 x 39569Kb downloads

...Are you using multiple tools for your network management needs? Put a stop to the daily searches, downloads and confusing reports that come along with disparate management tools! OpManager is...
network monitoring toolnetwork management softwareserver management software
Adventnet ManageEngine ServiceDesk Plus

Freeware by AdventNet Inc
184 x 37002Kb downloads

...ManageEngine ServiceDesk Plus is a web based, easy to use Help Desk and Asset...enables end-users to submit tickets via an online web form or through email. It automates several key...user satisfaction survey. Version 7.0 adds Enhanced Active Directory Integration, enhanced purchasing system with approver, business rules...
helpdesk softwareservice deskcontract managementitil help desktrouble ticketingsla managementinventory managementknowledge basepurchase order managementasset management
Developer Tool Marketplace News Screensaver

Freeware by DevDirect
63 x 674Kb downloads

Free Vista Files award
...tools for the job, every time. Its online directory enables software developers to quickly and accurately find...
cbdclassutilitycbuilderdotnetvbnetbeansaddinaspnetreusecnetdevelopmentclxvisual basicaddonactivexcodecomponentcomponettoolvisual studiodeveloperobject
Stardust Image Viewer 2003

Freeware by Stardust Software
108 x 888Kb downloads

...Stardust Image Viewer 2003 lets you easily step through images in a directory. 16 image types including JPEG-2000 are supported, and you can set all images to the same...
RSSOwl - Powerful RSS / RDF / Atom News Feed Reader

Freeware by RSSOwl
122 x 4000Kb downloads

Free Vista Files award
...newsfeeds. All data is stored in a single directory that can be put on a USB stick,...
aggregatorfeedaggregatorjavafeedreadereclipserdfopmlopen sourceswtatomportablenews readerrcprssnewsreadersnewsaggregatorfreenews aggregatortraycross platformsynchronizationnewsaggregators
...an entire drive such as C:\ or a directory such as C:\Mirc. Scanning can be stopped in...
Command Line POP Client

Freeware by Codeode
85 x 380Kb downloads

...Command Line POP Client is a free console utility that allows you to receive your e-mails to a local directory. It is suitable for batch jobs or whenever there...
2X ThinClientServer for Windows

Freeware by 2X
80 x 6936Kb downloads

...centrally by device, user, group or department (Active Directory / LDAP) via the web based interface. 2X...
thin clientsrdpterminal servicesthin client terminalthin client softwareterminal servercitrixserver based computing
Edraw Network Diagram

Shareware by edrawsoft.com
114 x 44719Kb downloads

Free Vista Files award
...Edraw Network Diagrammer is a professional network diagramming software with rich examples and templates. Easy to draw detailed physical, logical, Cisco and network architecture diagrams, using a comprehensive set of...
network designnetwork topologyldapnetwork architecturelogical network diagramcisco drawingnetwork drawinglan drawingactive directorywan drawing
TreeSize Free

Freeware by JAM Software GmbH
243 x 4976Kb downloads

...Every hard disk is too small if you just wait long enough. TreeSize Free tells you where precious space has gone to. TreeSize Free can be started from the context...
compressionfatdirectoryfat32spacehard diskfolderunicodetreesizeexplorerntfsfileutilitiesallocatedntfs compressiontreesize freentfsratiowastedwindows