Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
442 x 1719Kb downloads

Free Vista Files award a potentially large audience, using a standard web server as a bandwidth amplifier. All you need...and the ability to upload files to some web server. BS-Server runs in your computer, builds files, and sends this stream into a directory of your web site. The disk space the web server is always less than 5 MB, even...your broadcast by setting user-based passwords with your web server htaccess files....
Software602 Groupware Server

Shareware by Software602, Inc.
99 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
ManageEngine Applications Manager

Freeware by ZOHO Corp.
97 x 49152Kb downloads

...suitable for application monitoring, database monitoring, system monitoring, website monitoring, services monitoring, and custom application monitoring. Applications...Monitoring, Oracle Application Server, JBoss Monitoring, Tomcat Monitoring, WebLogic Monitoring, WebLogic Integration Monitoring, WebSphere Monitoring, J2EE Web...performance can be monitored by the SAP Module. Website monitoring involves URL Monitoring , URL Sequence Monitoring,...
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
No Spam Today! for Servers Freeware

Freeware by byteplant GmbH
103 x 15516Kb downloads

Free Vista Files award
...limiting protects your mail service from flooding or directory harvest attacks. Recipient addresses can be checked while...statistics charts and reports in real-time using a web browser, or using the NoSpamToday admin application. Data...
smtpemailspamlotuspop3dominospam filterexchangemail serveremail filterinternet server

Freeware by TM Services
55 x 0Kb downloads

...Put the web address into the field, press Enter, get will get the Google pagerank value and web site position in Google directory. It`s very convenient...
relevancepositiongoogle directorysearch engineseooptimizationanalyzepagerank
Adventnet ManageEngine ServiceDesk Plus

Freeware by AdventNet Inc
181 x 37002Kb downloads

...ManageEngine ServiceDesk Plus is a web based, easy to use Help Desk and Asset...enables end-users to submit tickets via an online web form or through email. It automates several key...user satisfaction survey. Version 7.0 adds Enhanced Active Directory Integration, enhanced purchasing system with approver, business rules...
helpdesk softwareservice deskcontract managementitil help desktrouble ticketingsla managementinventory managementknowledge basepurchase order managementasset management
RSSOwl - Powerful RSS / RDF / Atom News Feed Reader

Freeware by RSSOwl
118 x 4000Kb downloads

Free Vista Files award
...newsfeeds. All data is stored in a single directory that can be put on a USB stick,...
aggregatorfeedaggregatorjavafeedreadereclipserdfopmlopen sourceswtatomportablenews readerrcprssnewsreadersnewsaggregatorfreenews aggregatortraycross platformsynchronizationnewsaggregators
2X ThinClientServer for Windows

Freeware by 2X
77 x 6936Kb downloads

...centrally by device, user, group or department (Active Directory / LDAP) via the web based interface. 2X...
thin clientsrdpterminal servicesthin client terminalthin client softwareterminal servercitrixserver based computing

Freeware by
65 x 2008Kb downloads

...through your e-mail accounts. You can get remote directory listings and tree view, download/upload files and directories, remote PC from any e-mail client or web mail application. GetByMail gives you a unique ability...
download uploadftpgmailfile sharingremote shutdownshare filesremote accessp2pgetbymail
Ariacom Business Reports

Freeware by Ariacom
52 x 12815Kb downloads

Free Vista Files award
...whole range of reporting requirements, from publishing a directory over the intranet to multi-dimensional analysis on a...execute reports in Excel sheets - Report Scheduler, Web Report Server...
odbchtmlmultilingualwebdatabaseinformationbusinessbrowserdata-miningariacomreportingsql generationtxtinternetcross tablereportsanalysiscsvwindowsdata warehousequerytoolserverpdfdynamicxml
SkyFex Remote Desktop

Freeware by Tomsk, Inc.
79 x 2016Kb downloads

Free Vista Files award and help desks. It works directly in web browsers (Firefox, Chrome or Internet Explorer) and`s trade dress, - SkyFex integration into your web site, - Multiple monitors support, - Remote reboot,...
remote destopdesktop streamingremote accesshelp desk softwareremote assistancedesktop sharingremote supportonline collaborationremote desktop controlremote solutionremote support softwareremote control
Portal IT Toolbar

Freeware by Portal IT
47 x 248Kb downloads

...IT News - Zoom in, Zoom out - Web Search (powered by Google) - System Tools (clear...
PDF Linearizer Shell

Shareware by Inc
8 x 3207Kb downloads

...- count all PDF files`s pages in a directory (*.pdf); 10. PDF Linearizer supprots count PDF Pages...PDF Linearizer Shell does append linearization ( Fast Web View) to PDF documents;...
pdf document summaryedit pdfpdf summary makermodify pdfpage sizeoptimizeoptimize pdfpdf creatorpdf printerscale pagesmake pdf documentsscale pdfpdf optimization shellcreate pdf fileszoom pdfpdf pageresize pdflinearize pdf
Web Downloader

Freeware by Jose Falcao
62 x 655Kb downloads Drag and drop links directly from your web browser to the software window or copy to...
FastTrack FTP

Shareware by FastTrackSoft
26 x 2777Kb downloads connect an external HTML editor to edit web pages and other files. Fast-Track FTP supports Shell...5, download speed display, and assigning the starting directory (on a local hard drive as well as...
resumeftp softwaresshwebsiteftpsftp programtransfersslspftftp clientfasttrackuploadnavigatorsecure ftpcommandserver
Fast Link Checker Lite

Freeware by
7 x 17546Kb downloads

...links in HTML files directly, without accessing a web server, simply specify a file name and its...files in the folder are checked. From the web server side, Fast Link Checker Lite acts like...a web browser, so there is no difference what type...of web server a host is running. All properly configured...track Fast Link Checker Lite visits in the web server logs. Fast Link Checker Lite connects to...
site checkerlink checkerinvalid linklink searchlink validatorcheck linkslink verifierverify linksbroken linkvalidate linksdead link
BackStreet Browser

Shareware by Spadix Software
20 x 1753Kb downloads

...for Windows 9x/2000/NT/ME/XP. It is a high-speed, multi-threading website retrieval and viewing program. By making multiple simultaneous...server requests, BackStreet can quickly download an entire website including HTML, graphics, Java Applets, sound and other...current files. After downloading, all links within the website are reconstructed creating a complete hard drive copy...
offline web browseroff-linedownload websiteoff linedownload web siteoffline browserwebsite download
Harddisk Search and Stats

Freeware by Freebyte
31 x 600Kb downloads

Free Vista Files award
...who are handling text files, such as programmers, web developers, computer professionals, system managers and other demanding...
Menu Builder OS

Freeware by ArtistScope
26 x 74Kb downloads

...package that can be easily copied to your web pages. To increase your directory, simply paste another...
Groowe Search Toolbar

Freeware by Groowe
19 x 523Kb downloads

Free Vista Files award
...that way you spend less time searching for web pages on different engines, and more time looking...