1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server that contains SMTP/IMAP/POP3/LDAP services, corporate Instant...Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated BitDefender anti-virus and...real-time Commtouch RPD anti-spam protection. The included web client integrates e-mail, RSS feeds, public folders, contacts...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Adventnet ManageEngine ServiceDesk Plus

Freeware by AdventNet Inc
189 x 37002Kb downloads

...ManageEngine ServiceDesk Plus is a web based, easy to use Help Desk and Asset...enables end-users to submit tickets via an online web form or through email. It automates several key...can help you maintain a complete product catalog based on product type, that lists all assets owned...& user satisfaction survey. Version 7.0 adds Enhanced Active Directory Integration, enhanced purchasing system with approver, business...
 
helpdesk softwareservice deskcontract managementitil help desktrouble ticketingsla managementinventory managementknowledge basepurchase order managementasset management
2X ThinClientServer for Windows

Freeware by 2X
82 x 6936Kb downloads

...centrally by device, user, group or department (Active Directory / LDAP) via the web based interface. 2X...
 
thin clientsrdpterminal servicesthin client terminalthin client softwareterminal servercitrixserver based computing
ManageEngine Desktop Central

Commercial by ZOHO Corp.
149 x 104448Kb downloads

...Desktop & Mobile Device Management Software providing Role based Administration, Software Deployment, Creating Software Repostories, Patch Management,...Deployment, Asset Management, Warranty Tracking, Remote Control, Configurations, Active Directory Reports, User Logon Reports and Windows System...the administrator can easily manage any networks like Active Directory, Workgroup & Novell eDirectory. Key Features Supports...
 
warranty trackingremote desktop managementconfigurationspatch managementmobile device managementsoftware deploymentdesktop administrationinventory managementactive directory reportsrole based administrationpower management
ManageEngine ADManager Plus

Shareware by ZOHO Corp.
46 x 36864Kb downloads

...ADManager Plus is a wholesome yet simple-to-use, web-based Active Directory management solution that makes day-to-day AD management...the powers of the technician in the native Active Directory. The delegation can be effected to granular...a constitution for processes to flow in the Active Directory. This strengthens the security of your Active...
 
active directory workflowpassword managementactive directory automationsecurity delegationreport active directory usersexchange managementwindows network managementlogon reportsbulk user management
HTTP Commander

Freeware by Element-IT Software
19 x 2999Kb downloads

...Free for personal use only. HTTP Commander Web Based File Manager for Windows servers running IIS. It...Edit, View, Files search and advanced technical features: Directory Tree, Drag-n-Drop, Disk Quota, Own database with 250+...using Powerful and Fast technology ASP.NET. Version for Active Directory designed to use secure NTLM authentication and...it can automatically authorize users based on their security group membership. Users will only...
 
web based file manageronline file storageweb based file sharingasp file managerweb based file storageonline file sharingweb based file serveronline file managerweb file managerweb-based fileaspnet file manager
2X ThinClientServer PXES

Freeware by 2X
32 x 6985Kb downloads

Free Vista Files award
...centrally by device, user, group or department (Active Directory / Local Accounts) via the web-based interface. 2X...
 
server based computingrdppxesdesktop virtualisationthin clientsfree thin clientthin client softwareterminal servicesterminal server
Free Vista Files award
...sharing ("ad hoc file transfer" or "send files") Web browser transfers via HTTP/S (including multiple, large files...disable after X days, etc.). Multi-factor authentication. Advanced web clients support drag-and-drop, thumbnails, synchronization, two-panel transfers and...
 
ipadweb transferftp serverftpsfile sharingsend filessecure ftpmftftp automationinternet utilitiesshare filessftpsecure file transfermanaged file transferuploadnetwork utilitiesfile server
extVIEW Active Directory View/Search

Commercial by Extensions Software
32 x 1157Kb downloads

...a browser-based solution that makes viewing and searching Active Directory users and contacts fast, easy, and accurate....extVIEW enables you to utilize your existing Active Directory infrastructure to create an easy-to-use, web-based directory of...and readily: * Provide direct viewing access to Active Directory entries! * Maintain a corporate directory of...
 
directoryiisadsiuserldapsearchinternetintranetviewmicrosoftextranetemployeeactive directory
ORF Enterprise Edition

Commercial by Vamsoft Ltd.
23 x 3573Kb downloads

...e.g. regular expression-supported keyword filtering, attachment filtering or Active Directory-based recipient validation. Using the self-learning Automatic Sender...
 
dnsblanti-spamopen relayexchangespam filteremail filterrbl
Chroniker for Availability Monitoring

Demo by NRG Global
17 x 24377Kb downloads

...network components. Monitor Servers or any TCP Connect based application DNS, FTP, Web servers, Mail servers, and...DNS, Mail Server, LDAP Server, Network File Copy, Active Directory, and Custom Test Features and Capabilities Network...
 
log managementcitrix monitoring softwarenetwork monitoringavailability monitoringsystem monitoringdatabase monitoringwebserver monitoringserver uptimebusiness dashboardsapplication response time

Freeware by NRG Global
16 x 8073Kb downloads

...ICMP/ Ping check and track any TCP Connect based application: DNS, FTP, Web servers, Mail servers (SMTP,...Database Test (Oracle,MySQL,Informix,Interbase,PortSQL) use your SQL queries - Web Server Test(Apache,Web Sphere,& others):match page content - Mail...(SMTP, IMAP, POP3) - LDAP Server Test (Microsoft Active Directory, Open LDAP, Novell eDirectory, Sun Java System...
 
network monitoringserver uptimesystem monitoringwebserver monitoringfile monitoringdatabase monitoringcitrix monitoring softwareavailibility monitoringavailability monitoring
Help Desk Authority (formerly BridgeTrak)

Demo by ScriptLogic Corporation
105 x 56832Kb downloads

...issue folder filing system, hierarchy issue structure, skills based assignment of issues, custom and required user fields,...auto issue escalation, asset inventory/management, advanced data searches, Active Directory integration, email to ticket conversion. iPhone client...
 
troubletickethelp desk softwaretracking
Active Search Engine

Shareware by Myrasoft
76 x 887Kb downloads

...application that allows you to create your own web directory in just minutes. It features an appealing...user interface and highly-developed administration tools for advanced web page management and approval, category creation, keyword based...excellent and automated source for additional advertising revenue. Active Channels include real time news from prestigious sources...among others to keep your visitors coming back.
 
create web directorysearch engine softwareweb directory scriptweb directory softwareasp applicationsweb directory portal softwarehow create web directory
Free Vista Files award
...(SNMPv1 and SNMPv2c) and NetBIOS . Support for Active Directory, ADSI, CPU Usage, directories, disk health, DNS,...Oracle logging and reporting facilities. XML and XSL based Web Interface. XML and XSL based Reports....
 
network managementinternet solutionsnetwork monitordiagnostic softwareinternet softwarenetwork server monitornetwork server software
timp

Commercial by Tipic Inc.
79 x 1722Kb downloads

...a wide array of customer needs. - Windows based TIMP runs on Windows 2000 and has Active...
 
instantxml-rpcplugwindowscommunicationmessagingsoapjabberrealtimeserver
Akeni Enterprise Instant Messaging LDAP

Shareware by Akeni
59 x 8007Kb downloads

...messaging system that offers strong encryption, along with Active Directory / LDAP integration. It also provides corporate...the use of shared public groups and role based user access rights. All messages can be logged...your users can access the system using a web browser. Features includes business IM chat, conference, file...transfer, notification, alerts, online status, and optional web client module. Shared public folders allows the administrator...
 
enterprise instant messengerakenibusiness instant messagingnotificationcorporatesocial networking softwarecollaboration software
...local system credentials. In addition to Domain or Active Directory security, each Windows desktop and server system...
 
migrationlanicumanagementmicrosofthelp deskwindowshipaapassword resetpasswords2000forgot passwordsingle signsecurity2003hashcommon credentialssoxpwdump
cPWD

Shareware by Absolute Dynamics
28 x 725Kb downloads

...the local administrator account across the network. Search Active Directory. Target multiple Administrator accounts based on the...
 
rename local admin accountchange local admin password
RBackup for Online Backup Services

Demo by Remote Backup Systems
22 x 97954Kb downloads

Free Vista Files award
...level), multiple instances of SQL Server, System State, Active Directory, Hyper-V, VMWare, Full Drive Images, normal files...
 
remote backupweb backupinternet backuponline backuprbackup