1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
File Backup Watcher 3 Lite Edition

Shareware by Desktop Software
3 x 2534Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
synchronizewindows2000win32compressionpkzipauto-dialauto-loginautomaticbackupwindows98multi-usercopyrestoremirroringpasswordprotectionmulti-threadedsafekeepwindowsnt
File Backup Watcher Lite Edition

Shareware by Desktop Software
17 x 15335Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
win32backupmirroringcopymulti-threadedsafekeepautomaticbackupwindows2000restoreauto-dialsynchronizewindowsntpasswordprotectionauto-loginmulti-usercompressionpkzipwindows98
File Backup Watcher 3 Professional

Shareware by Desktop Software
4 x 8044Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
pkzipwindowsntcompressionautomaticbackupmirroringmulti-userauto-dialsafekeepmulti-threadedwindows2000passwordprotectionauto-logincopysynchronizerestorewin32windows98
BroadCast  Printing

Shareware by Batch-Print-Files
3 x 1783Kb downloads

...a batch process. It supports Schedular and DIRECTORY WATCHER features. It schedules printing of many files for...
 
printing softwarebroadcast printing softwarefile printing schedulingprint all filesbatch files printingprint softwarebroadcast batch printingprint files batchprinting schedulerbatch printerprints files batchprinter application
File Backup Watcher Professional

Shareware by Desktop Software
12 x 13158Kb downloads

...way out? Yes! There is! Presenting File Backup Watcher by Desktop Software, the unique feature-packed, fully automated...forget about backup hassles for good! File Backup Watcher allows all kinds of backup activities from manual...Thanks to user-friendly interface migrating to File Backup Watcher is actually a snap. Multiple wizards allow on-the-fly...
 
backupmulti-threadedwindows2000auto-dialrestorewindows98compresscopypkzipmulti-usermirroringwin32automaticbackupsafekeepauto-loginsynchronizepasswordprotectionwindowsntcompression
Advance Keyboard Monitor

Shareware by Hack Email Password
16 x 1638Kb downloads

...Advance stealth keyboard watcher program records all keystrokes and captures windows screen...due to application crash or closed. Advance keystroke watcher tool is not caught or detected by any...
 
surveillancesoftwarekeystrokewatcherprogrampresstypedcaptureinvisiblekeyloggermonitoringrecordsantivirustooladvancestealthundetectedkeystrokeskeyboardactivitiesscreenshotpassword
Keyboard Keystrokes Logger

Shareware by Free keylogger
131 x 1638Kb downloads

...Download keyboard activity watcher software records computer keyboard activities in a hidden...display on desktop, control panel, taskbar. Keyboard activity watcher tool provides user help manuals to guide user...
 
presskeyloggerkeystrokessurveillanceactivitykeyboardmessagestrackwatchersoftwareurlemailpasswordvisitedchatantivirusrecordskeypadmonitorundetectedtypedapplicationstealth

Freeware by vdocapture.com
32 x 4854Kb downloads

...Netcam Watcher Professional is a Digital Video Recorder for Network...or people walking past the window. Use Netcam Watcher Remote Control to view your cameras and recordings...
 
cameranetwork
DeltaSpy

Shareware by Bitberry Software
15 x 2145Kb downloads

Free Vista Files award
...Check all your favorite sites for updates - as easy as checking your email. Tell DeltaSpy which web sites to monitor, and how often you want these web pages searched. The...
 
website watcherwebsite monitoringdetect changes web pageweb monitoringurl watchercheckerbookmark manager
FreeZ Online TV

Freeware by FreezSoft.com
36 x 819Kb downloads

...are streamed through your Internet connection. It allows watcher to watch directly into TV. You can watch...
 
onlinetvsatellitetvinternettv
PingIT

Shareware by Desktop Software
11 x 198Kb downloads

...This program was developed for those people who want to know all the time about network loading, who wants to understand who is guilty of slow speed loading of internet...
 
portmonitorutilitiestrayserverstatussocketnetworksystemwebcheckwatcherpingitserviceicmploadingadresspinger
...Watch up to 24 webcams simultaneously! Save any frame as a picture, or use any webcam as your screensaver. You can zoom in and zoom out of any webcam. You...
 
security camera softwarehome security camera setupscamera surveillance softwarelive web camswebcam softwarenetcam softwarewireless security camerascamera network softwaredigital video recorder
Smart Suite for MySQL

Shareware by Desktop Software
11 x 9059Kb downloads

...for you. Smart Suite for MySQL includes: Backup Watcher for MySQL (for database backup), SQLBalance for MySQL...databases are synched, viewed or backed up. Backup Watcher for MySQL is very flexible, allows you to...
 
databasesoftwarerestorewindowsautomysqlbackup
Online TV Player

Freeware by Online TV Player
109 x 1675Kb downloads

...online radio stations on your PC. It allows watcher to watch directly into TV without having to...
 
onlineinternet channelsweb
Free Vista Files award
...The TAPIMaster® TAPI Line Watcher allows you to test the TAPI interface without...
 
tapitesttool
...FolderMonitor is a fast, effective and easy-to-use disk change monitoring solution allowing one to monitor one or more disks or directories and to detect file creations, file modification,...
 
folder wacherfile watcherfolder monitorfile monitor
OstroSoft Internet Tools

Shareware by OstroSoft
16 x 4873Kb downloads

...Award-winning integrated set of network (Internet) utilities. Contains scan wizard, port and domain scanners, connection, host, service mail and html watchers, ping, traceroute, netstat, ns lookup, ftp, whois, ph,...
 
watcherdomainconnectionnetstatinternetostrosoftportfingerscannertoolspingftputility
ShareAlarmPro

Shareware by Nsasoft US LLC
1 x 2945Kb downloads

...a share. Apart from that, ShareAlarmPro includes folder watcher functions. You can perform folder monitoring and folder...events (access to shared folders, security events, folder watcher events) in an HTML format....
 
shared foldersaccess monitoringalertaccess detectnetwork accessnetwork sharesnetwork sharingnetwork securityfolder monitoringnetwork protectionfile sharesecurity eventsnetwork monitoringevent logintrusion detection
A-one Home Looker

Shareware by yaomingsoft
11 x 1000Kb downloads

...A-one Home Looker is a powerful video monitor program. It could let you see your home whenever and wherever by capture video through webcamera and send screenshot to your...
 
home lookhome monitorhome watchervideo capture
...Easy File and Folder Watcher lets you watch monitors activity in folders on...
 
watchingfilesmonitor activitymonitor foldertoolscontentutilitiesspyprotectmanagesecuritymonitor file