1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Free Download Manager

Freeware by FreeDownloadManager.ORG
1047 x 7039Kb downloads

Free Vista Files award
...Free Download Manager is a powerful open-source downloading application that has...able to work under non-admin accounts. Free Download Manager is the first social download manager inspired by...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
Replay Media Splitter

Shareware by Applian Technologies
127 x 15909Kb downloads

...Media Splitter is a really easy audio and video editor and file joiner. Simply load a video...and easy. Replay Media Splitter edits these popular video and audio formats: MOV, AVI, WMV, ASF, WMA,...You can remove commercials from all your favorite videos or trim dead air away from all your...
 
wma editorwmv editorvideo editormp3 editorasf editoravi editoraudio editor
Media Catalog Studio Lite

Freeware by ManiacTools
183 x 2926Kb downloads

Free Vista Files award
...Is your video and music file collection growing out of control,...
 
wma tag editorcollection managervideo managerid3 tag editoroggmovies organizeraudiomp3 taggervideo organizermusic organizerwmvcddbmpegmedia organizerpalylist managermp3 organizermp3 managerape
AV Manager Display System (Freeware)

Freeware by Viscom Software
118 x 8488Kb downloads

...AV Manager 3.0 supports VIDEO, IMAGE, SCROLLING TEXT, WEB PAGES...of contents with a sequence of playlist. AV Manager 3.0 by Viscomsoft is a simple and easy.../ LCD displays, Plasma TV, Projectors, Bulletin or Videowall ) remotely across a network ( LAN /...WAN or Internet). AV Manager 3.0 can be applied at shopping malls, departments,...
 
display systemlanledlcdimagebulletinmulti media playerplasmaprojectorsvideowallinternet
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...bits) is a browser for your 3D, photo, video and audio files. This is a fast and...powerful media manager to browse thousands of files thanks to its...Slides show >> Open your images or your videos in the built-in viewer. Use one of these...Image bending - Filters - Slides show - Video playing - Video image extraction >> Organize your...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
Download Accelerator Plus

Freeware by Speedbit LTD.
521 x 912Kb downloads

Free Vista Files award
...10, the world`s fastest and most popular Download Manager and Accelerator, has been installed over 300 million...higher level of speed and efficiency. DAP 10`s Video Downloader and Converter lets you download web videos...it also supports more sites than any other Video Downloader. Instant Video Play lets you watch and...seconds from starting to download. The new DAPsters Manager feature offers a one-click solution for downloading from...
 
speedbitsecureinternetdownload accelerator plusfacebook downloadervideo downloadorbitdapidmdownload managerfastgetrightoptimizeprivacyconverterstreamingweb acceleratorfree

Freeware by Backtec Software
106 x 7339Kb downloads

...attribute control), BlockIt, Tape Calculator, 2 Calendars, Change Video Resolution, RGB Color converter, Drives Info, File Inventory,...
 
checkbookrgblfncolornotesschedulercalendarfreewaremoveareacodes
PSP Video Manager

Freeware by SharewareGuide.net
288 x 901Kb downloads

...*Great news:PSP Video Manager1.1.14.1015 is released. *PSP Video Manager 1.1.14.1015 is a PSP Video file manager freeware...PSP owners by Sharewareguide.net, which can transfer PSP video files between your PSP and computer with ease...is very popular with the PSP owners. PSP Video Manager helps you easily import PSP MPEG4 files to...your PSP to your computer. While transferring PSP video files, you can copy or move the video...
 
transfer psp videopsp file managerpsp video managersony psp movie manager
DivX Play Bundle (incl. DivX Player)

Freeware by DivX, Inc.
163 x 15195Kb downloads

...all .AVI and .divx files that contain DivX video and MP3 audio (including DivX 3, 4, 5...and 6 video formats), and enables access to rented and purchased...of DivX including scene selection menus, chapters, subtitles, video tags and alternate audio tracks. The latest version...of the DivX Player adds a download manager that allows you to download multiple videos, pause...
 
wm9divx convertermpegdivx dvdencodingh264h263divx windowsdivx codecdvd divxburn divxdivx encodeconverting divxbundlewmvplayernew divxdivx toolswindows mediaxvid
Kazaa Download Studio

Freeware by CyZeal
65 x 528Kb downloads

...Kazaa Download Studio is a Kazaa Media Desktop (including Kazaa 3.0) add-on that includes a vast array of features to boost your P2P experience. Included features consist of...
 
limewirekazaafreep2pfile sharingmp3morpheus
Frigate3Lite

Freeware by Helmsman
47 x 5200Kb downloads

...of your valuable. There are much better file manager alternatives that are easier to use and offer...synchronization feature with FTP support. Since most file manager users are professionals, Frigate 3 is packed with...perks to the brink. Like music? This file manager comes with an audio/video file player/viewer and MP3...other handy extras, like TreeNotes, Quick Launch, Startup Manager or SmartPad.
 
directoryfile manageftparchiveexplorerfolder
Acala DVD Ripper PSP Bundle

Shareware by Acala Software Inc.
40 x 3429Kb downloads

...your DVD movies to AVI, VCD, SVCD format video regardless DVD CSS and DVD Region. The build-up...profile settings solution and easy customize settings for video size, frame rate, video bitrate(quality), audio bitrate(quality), aspect...clip to convert ). 3) Support almost popular video files (DIVX, XVID, AVI, MPG, MPEG,VOB,VCD,SVCD,etc.) 4) Support...support for the latest industry standards ensures the videos you create with best picture and...
 
dvd avidvd copy avixvid pspdvd backup mpegavi pspmpeg pspdvd copy mpegdvd backup svcddvd movie avidivx pspmovies pspdvd movie vcdmovie pspdvd backup vcddvd ripperdvd vcdmpg pspdvd movie svcddvd movie mpegdvd backup avipsp moviesdvd mp
Web CEO Professional Suite

Shareware by Web CEO
44 x 30214Kb downloads

...Web CEO you receive high-quality support which includes video tutorials, quick start guide, support center. If that`s...
 
web analytics toolkitwebsite auditsearch engine optimizationkeyword researchweb promotionlink exchangesearch engine submissionlink buildinghtml editorkeyword ranking checkerftp upload managerseosite uptime monitoring tool
SlimBrowser

Freeware by FlashPeak, Inc
12 x 3303Kb downloads

...SlimBrowser is listed below: 1. Fast internet download manager boosts your download speed by up to 12...form for you automatically. 3. Download online streaming videos to mp4 file at 10x speed. Also let...you extract mp3 file from the downloaded video file. 4. Ad blocker eliminate ad banners or...
 
form fillerpopup killerfree browserinternet browserbrowser downloadbrowser softwarebest web browserfastest web browser
...Interface. It can record sounds from internet broadcasts, video game or programs like Windows Media Player, Real...into Wav, Mp3, Wma, Ogg format. It can manager and edit your recorded audio file with Inside...
 
mp3audiorecordwmaoggbroadcastmicrophonewav

Freeware by Axmo Inc.
34 x 1639Kb downloads

...faster than any other P2P application. The download manager uses the browser to manage the downloaded files...
 
searchkazaaedonkeyplugininternetchatpeoplegnutellap2pnewstoolbardownloadswebbrowsermusic
Likno eLearning LMS

Commercial by Likno Software
12 x 339Kb downloads

...pictures, sound, video, flash or java - File Manager & Digital Library: Upload, organize, use & share...
 
learning platformlmscourse management systemsoftware elearningweb based trainingscormlearning management systemscoursewarelearning management softwaresoftware e-learning
...video. You can make two types of subjective video video comparisons and apply different ways of analysis...comparison. Metric software contains two programs: * Task manager (planner and statistics calculation tool) * Player -...
 
perceptual video qualitysubjective video qualityquality measurement
GetBot

Freeware by GetBot
35 x 321Kb downloads

Free Vista Files award
...with GetBot - the free, no spyware download manager for Windows. Relentless: GetBot is relentless, recovering broken...all the pictures on a page, or every video in an entire site. You can see the...picture is a button, an image map, a video capture, or a thumbnail, making it easy to...
 
resumeparsedragcrawlwindowsloopwebleacherextractinternetsnatchrecoverprogramdialcollectblockscourmp3accelerategetbotleecherget botrippumpsearchhttpfixboostsoftwarestripscheduledefeatftp
Free Vista Files award
...(per call) - NEW: 5 minutes free Skype video recording (per call) - Call Scheduler - Conference...Call manager - Add notes to each recording during or...
 
productswebsitecommunitymachinesystemsupportanswering machinemessagesmailautomaticchatvoicemailupgradescontactvoipdesignskypemessagingpamelafeaturestextsoftware