1 2 3 4 5 6 7 8 9 ... 45 46 47 48 49 50 51 52 53 54

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Stardust Impressionist Paintings Screen Saver

Freeware by Stardust Software
147 x 2801Kb downloads

...image. Features include an animated introduction sequence with video and sound, customized screen saver settings dialog box,...
 
screensavergauginimpressionistpaintingsrenoircezannemonet
Balthers Graphic Groove Box

Freeware by Balther
52 x 20368Kb downloads

...for the professional digital artist, handling graphics, Flash, videos and 3D. PC key and MIDI control with...the PC keyboard. Connections for in/output-devices like DMX, video and audio tracking etc. is under development. All...
 
animationreal timemidivideodigital art toolmoving visualsinteractivesoftwareeffect
AviTricks Classic

Freeware by Bobyte Software
125 x 1119Kb downloads

...AviTricks is a non-linear, non-destructive AVI video editor with real-time preview. It makes cutting and...and includes a wide range of built-in adjustable effects that can be used separately or in combination....and many more.) Besides the preview screen, the video you are working on is also represented clearly...sub-project approach allows an unlimited combination of filters, effects and overlays, and will also make it easy...
 
mp3videorubber-bandtransitionsmultimediamovie editorvideo editordivxaudiompegtimelinebobytewmv
...Free video effect of old cinema plugin for VirtualDub. Make...you video like CHRONICLE (several effects: noise, color, speck of...
 
cinemavirtualdubprocessingeffectoldermasteringvideopluginfilm
Wavepad Audio Editor

Shareware by NCH Software
205 x 887Kb downloads

Free Vista Files award
...noise reduction and click pop removal * Special effects include reduce vocals, distortion, chorus and more *...Batch processing allows you to apply effects and/or convert your files as a single function...
 
wavepadmp3 editmusic editing softwareedit musicmp3 editorwav editormusic editor
STOIK Video Converter

Freeware by STOIK Imaging
95 x 29309Kb downloads

...One-click Video Format Conversion for Your Player Watch movies in...optimum quality on your video player! STOIK Video Converter Pro takes video files in any size...and format, producing clips that match your video player perfectly. With more than 275 presets, STOIK...Converter Pro knows exactly the specs of your video player, including its screen size, resolution, bitrate and...
 
conversionfiltersetsmp3eposidemovfpsfreeware video converterframeratewindows mediawmvclipsmpeg mpegmkvdivxcodecsscenespliteditorstoik
DDVideo SWF to iRiver Converter Standard

Shareware by DayDayVideo
18 x 10794Kb downloads

...to iRiver converter application, which can convert swf video to iRiver WMV video and AVI, MP4,H.264/MPEG-4 AVC(.mp4)...video formats,and also extract audio from video files to MP3,OGG,WMA audio format for all iRiver...DP350,iRiver PMP etc If checked "EnableGain",normalizes all swf video sounds at the same level without loss original...sound quality,each video or music will improve their level to make....
 
swf iriveraudio gain3gp gainswf iriver converterswf iriver converter downloadmp3gainconvert swf irivervolume gainsound effectsadjust volumenormalizer volumemp4 gainaudio convertervideo audiovideo gain

Freeware by t@b
131 x 2625Kb downloads

...t@b ZS4 is advanced multi-track video editing and compositing software with more than 150...built-in video effects including excellent color and chroma keying tools, distortion...effects, color adjusters, pattern generating effects and many others. Effect containers can be used...to restrict the processing of contained video effects by shape or blending logic. Other features include...
 
bluescreeneditingmulti-trackgreen screenmulti trackzwei-steindistortion effectszoomeditorvideo compositinggreenscreenchroma keyblue screenpanzs4freecompositordistort video
...Enjoy the effects and the visuals in this screensaver. Watch the...colors of leaves changing slowly in the live video shot. Download to feel the spirit of Thanksgiving...
 
colorscreenthankfulthanksgivinggoodflashwishesscreensaverhappyleavesjoyfulvisual
Macromedia Flash Player

Freeware by Macromedia
247 x 926Kb downloads

Free Vista Files award
...rich Web experience. Highly Expressive Deliver low-bandwidth, high-quality video with advanced compression technology. Create innovative media compositions...with 8-bit video alpha channels. Create pixel-perfect text using the advanced...text rendering engine. Add real-time dynamic effects with filters for Blur, DropShadow, Glow, Bevel, Gradient...for frequently-used features such as text scrolling and video playback.
 
freeware
Slideshow pro Freeware

Freeware by IN MEDIA KG
190 x 6287Kb downloads

...-equipment (TV map, Capturecard etc..) -More than 125 slideeffects for slideshows -over 50 effects for pictures -printing...
 
vcd slideshowsphoto vcdphoto videophoto dvdphoto svcddvd slideshowsphotoalbumtransition effectspicturephoto archive
Picopolo

Freeware by GDMcom mbH
57 x 63099Kb downloads

...as photo books, as interactive slide shows or video DVDs. Provided designs for all presentation modules also...
 
gpscoordinatesphoto administrationdigital picturespicture administrationimage organisationmaptravelsoftwarevacationfreewaregeo referencingjourneyimage editingpresentationgraphicsdigital imagesroute
Fat Fish

Freeware by Bertesh Studios
27 x 2317Kb downloads

...game has 3 original music and several sound effects that transform this game into a brutal combination....very customizable, you can select a lot of video modes like 320x240 to 640x480, change the controls......
 
free gamesarcadewindows gamesfreeware
ImTOO PSP Music Suite

Shareware by imtoo.com
25 x 58693Kb downloads

...It comes with two practical programs: ImTOO PSP Video Converter and ImTOO CD Ripper. 1.Convert audio CDs...many other formats with excellent audio quality. 2.Convert video files in any popular format and even HD...3GP, ASF, and so on to PS3 MPEG-4/AVC video (480p, 720p, 1080p). 4.Convert among most audio formats:...rate, codec, audio channel and quality. 4.Add audio effects to get customized music file, including fade-in, fade-out,...and BMP. 11.
 
psp audio convertermusic for pspripperpsp video converterpsp musicpsp music converterpsp converter
DVD Audio Ripper

Shareware by imtoo.com
37 x 9618Kb downloads

...Studio is one of the pioneers in DVD, video and audio software development. We endeavor to develop...
 
convert dvd mp3rip dvd audioaudio dvd extractdvd audio ripperdvd wavrip audio from dvd
Seahorse

Freeware by PhotonFX Software
66 x 31206Kb downloads

Free Vista Files award
...Flash Buttons, Logos and Intros with optional Sound Effects * Apply your own Logo Image * Insert...Midi Music Files * Insert MPEG and AVI Video Files * Insert SWF Flash Movies * Create...
 
homepage generatorsitebuildermicrosoft frontpagewebsite generatorhomepage toolweb authoring toolhomepage-builderwebsite toolhomepage creatorweb page builderwebsite builderweb site softwarewebdesign software
GFX Alchemy

Shareware by GFXAlchemy.Com
45 x 8469Kb downloads

Free Vista Files award
...selected object, full screen), slideshow, HTML map creation, video decompiling and construction, Photoshop plugins, TWAIN acquire, etc....
 
rotategraphicsacquiremirrorphotosspecial effectseditorslideshowpaintconverterthumbnailerresizeprintanimationfliptwainzoombatchscreen captureclipartvieweroptimizecropannotate
Blaze Media Pro

Shareware by Mystik Media
108 x 19435Kb downloads

Free Vista Files award
...DVD burning are supported. Other advanced features include video capture, video creation, combining, and extraction, video editing,...FreeDB support, and more. The audio content of video files can be extracted and saved to sound...be extracted to images files in batch mode. Video files can also be created from still frame...CDDB and used to automatically name saved files. Video editing is available for AVI (uncompressed), AVI (compressed...
 
burningconversioneditorcopiercompressionmpgvcdrecordermusicmpegoggeditingwmarippingvideoburneraudioconvertercompressorripperdvdmp3copycapturwmvsoundwav
CDH Media Wizard

Shareware by CDH Productions
36 x 9842Kb downloads

...burning, playback (including full playlist and full screen video support), and much more. Powerful, yet easy to...use audio, video (VCD), and data CD/DVD burning are all fully...supported. Other advanced features include video capture, video creation/combining/extraction, video editing, batch video processing, media management,...CDDB/CDDB2/FreeDB support, and more. The audio content of video files can be extracted and saved to sound...
 
sndviewervivoencodermovmusicaudiowmaplayeraiffbatchdecodermp3apple movie quicktimeconverterplaylistsmidirecordermpgrippervideoeditorsoundmpegwav
CDH Image Explorer Pro

Shareware by CDH Productions
30 x 21002Kb downloads

...The most complete, all-in-one image and video solution currently available. Allows for fast viewing, editing,...and management of all your image and video formats! Read and write support is provided for...and thumbnail browser, GIF animation creation, GIF to video (AVI, MPG, WMV) and video (AVI, MPG) to...GIF conversion, video editing, video creation / decompiling, video conversion, batch video processing, context menu previewing, 2000+.
 
textprintzoomtwainshapeconverterrotatemirrorbatchclipartthumbnailingresizeeditorcropacquirevideooptimizeviewerflipslideshowprocessingphotoscapturegraphicsanimationspecial paint effectsplayer