1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SID DVD-Video Image Extractor

Freeware by SoundInDepth.com
48 x 12128Kb downloads

...Free DVD Image Extractor is an easy tool which enables you to play DVD-Videos and capture...snapshots . It supports three tools for capturing snapshots which are Single snapshot ,...Timed snapshots . By Single snapshot you can capture a single snapshot from the video and continuous...snapshots allows you to capture a portion of the video as a sequence...of images.
 
rewindpauseturningmillisecondssingle snapshotonoffaudiodvd-videocontinuous snapshotssequencetimed snapshotsstopimagescapturefast forwardportionplayextractor
Exsate DV Capture Live

Freeware by Exsate Software
143 x 1695Kb downloads

Free Vista Files award
...Exsate DV Capture Live is a program for capturing DV video...time stamp and automatically imprints it on a video frame: - Once a day; - Once an...recompression to AVI or ASF formats - recompresses captured video to an AVI file with any DirectShow...ASF file (WMV) on the fly. Scenes detection, capture to multiple files - detects scenes and writes...multiple files.
 
softwareminidvmoviewmvvideompgmpeg2daterecompressdivxmpeg4toolasfvcdcapturestampdvdsvcddvc
Screen Master

Freeware by Zhenxiao
70 x 383Kb downloads

...Screenmaster is a tool for capturing both snapshots and video information from...your screen. It allows you to capture from the whole screen a specific window, or...a user-defined region. Screen master supports WMV video format and most major picture formats such as...
 
video capturesnapshotscreen capturerecord screen
Capture Professional

Demo by Creative Softworx, Inc.
36 x 3257Kb downloads

...Capture Professional v6 combines powerful image and video capture capabilities with the most powerful image editor found...in any screen capture tool. Its multiple document interface easily handles multiple...images and videos at the same time. This makes it easy...to pick and choose the screen captures that you really want to keep or to...compose an image from multiple images.
 
audioprintwindowseditorscreendirectximagecapturevideo
...FrontCam is a screen recorder software. It can capture the action from your screen into standard AVI...is also recorded. You can use it to capture screen into static pictures too. It is an...idea tool to make software demonstrations, develop videos for training and tutoring. With FrontCam you Can...: develop videos to demonstrate features of your new software or...tutoring.
 
software downloadscreen capturerecorder downloadcapture aviscreen videorecord screenrecord aviscreen recordercapture screen
...turns your PC with WebCam into an advanced Video Security and Surveillance System. By WEB BROWSER,Remote View...DDNS system. With this software you can record video with a programmed schedule. It uses MPEG-4 compress...format.The video record size is about only 120~250M/Hour. This software...provides customizable Alerts like Video Recording, Photo Snaps, Sound Alarms, E-mail and phone...can also schedule Monitoring sessions. Features: 1.
 
security systemmpeg-4telephonewapguardmpeg4networkremoteemailwebcamcameravideomobile
Driver Genius

Shareware by Driver-Soft
58 x 10585Kb downloads

Free Vista Files award
...What`s more, this powerful and easy driver management tool can analyze your system and recommend suitable drivers...vast majority of hardware devices such as motherboards, video cards, sound cards, network cards, modems, monitors, mice,...keyboards, digital cameras, video capture cards etc....
 
driver installdriver backupdriver cleanupdriver restoredriver update
ABCPix

Shareware by Alberto Farinelli
25 x 3232Kb downloads

...ABCPix is a easy-to-use tool for viewing, browsing and managing images and videos....You can easily grab picture shots from videos and cut areas from images and videos. It...interface - thumbnails preview of all images and videos in folder - picture shots from video -...image capture in clipboard - zoom and fit-to-window functions -...
 
quicktimempeggraphicsthumbnailsgifmpgvideojpgpicturescreensaverimagebmprealmediaviewer
CodedColor PhotoStudio Pro

Shareware by 1STEIN Corp.
25 x 58000Kb downloads

...watermark text, image annotations, panorama stitch & animation, video capture, PDF album export, photo layouts, collages, frames,...
 
acdseealbumexifimageconversionthumbsmultimediagraphicsbalancetifphotogpseditorpanoramaprintpublishbmpbatchpdfviewerdtpjpgorganizegifjpegflashrawcameraiptcarchivepicasawmfcatalog
FlashCAD

Shareware by Digitarch
39 x 44588Kb downloads

...drawing thanks to the easiest and most complete tool available today. Your expectations are immediately projected on...bitmap editor embedded, image processing. 3D rendering, 3D video in AVI format. Images bilinear deformation, Inverse Perspective...seconds! You will enjoy it! You can realize video in AVI format of your 3D models just...are not architects nor drawers; therefore they cannot capture the needs of the operators who will work...
 
vectorray tracingmanagingplottercartographicdrawingsbitmapdwgimageautocadtexturesanimationvideoterritorialacquirerenderingdxfrasterinverse perspectivemapping
Take5

Demo by CellSoft
43 x 4928Kb downloads

...beginners and pros alike. With Take5 you can capture images from a video camera or webcam and...program,Take5 has evolved into a high quality animation capture and editing tool. It is used to produce...and studios. Take5 supports webcams, analog and digital video cameras, including high resolution cameras, and Canon LiveView...looping are available while animating, as well as video noise reduction. Editing the animation is easy and...
 
stop motion foronion skinningstop motion programanimation with webcamclay animation softwarehigh resolutionexposure sheetframe averagingrotoscoping
4Easysoft DVD to MOV Suite

Shareware by 4Easysoft Studio
13 x 11059Kb downloads

...of converting DVD to MOV and converting MOV video at the same time. In fact, it combines...DVD to MOV Converter and MOV Video Converter into the all-in-one tool. Key Features 1.Improve...DVD to MOV Suite allows you to adjust video Brightness, Contrast, Saturation and Volume at will. Tips:...When you convert the interlaced video formats such as 720i, 1080i, for you to...the picture.
 
dvd mov converterconvert movconvert dvd mov
WebCam Monitor

Shareware by DeskShare
159 x 26217Kb downloads

Free Vista Files award
...WebCam Monitor turns your PC into a video surveillance system. Use any camera with WebCam Monitor...on your cellular phone for 24-hour coverage. Automatically capture photographs, or record video and audio in highly...supports USB, FireWire, and many types of TV capture card. All settings, such as alerts, photo, and...view to avoid false alarms. Broadcast a live video and audio stream over your local network or...
 
maskwebcam softwarepanremote monitoringmotion detectionvideo securityuploadlogtiltzoomvideo surveillancealarmbroadcaststreamingemail alertschedule
Free Vista Files award
...Screen Capture Master - is a powerful screen capture application that prints screen and grabs screen shot...from Windows desktop. If you want to capture desired desktop screen pictures at will and select...capture area in rectangle, window, control, etc., some video games, Screen Capture Master can be your cool...and powerful tool. Screen Capture Master guarantees professional results for your most demanding...
 
utilitiesgraphiccapture screenprintscreenscreenshotprint screensoftwarescreen shotgrabscreen capturepictureimagesave
!Quick Screen Recorder

Shareware by Etrusoft Inc.
39 x 576Kb downloads

Free Vista Files award
...Quick Screen Recorder is a video capture, screen recording tool for recording screen activity...into normal AVI video files. When you move the cursor, launch a...even can sound. Use it, you can change videos to demonstrate features of a new software,or creating...
 
video capturescreen recordingvideo screen capturescreen recorder
My Screen Recorder

Shareware by DeskShare
61 x 12242Kb downloads

Free Vista Files award
...AVI or WMV file. This advanced screen capturing tool can capture anything you see on the computer...the entire desktop, windows, menus, cursors, and even video with sound. My Screen Recorder can capture the...use. You can select from a framed area capture or full desktop recording. You can adjust the...the perfect way to record a webinar or video call, including audio. Create flawless recordings of Internet...
 
desktop recorderscreen recorderscreen capture
1st Screen Recorder

Shareware by ScreenRecorder.us
29 x 644Kb downloads

...1st Screen Recorder is a tool used for recording Screen Activity and Sound into...standard AVI Video files. If you move the cursor, launch a...You can use 1st Screen Recorder to develop videos to demonstrate features of a new software, for...when screen recording or paused 7. Select the video encoder for your AVI file 8. Adjustable capture...
 
video screen capturevideo capturescreen recordingscreen recorder
...Gold is an easy-to-use, fast, and powerful screen video recording software for recording on-screen activities into video...microphone is also recorded. It is an ideal tool to make software demonstrations, develop videos for training...can use Screen Recorder to: * Create demo videos to demonstrate how to use computer software. *...movies used in user training and tutoring. * Capture streaming videos to hard disk for local playback.
 
moviedownloadscreen capturesoftwarescreen recordercapture screenrecord streaming videogame recorderfree screen recorderscreen recorder softwaredesktop recordersave streaming videoscreen video recorder
...Easy Screen Capture Video is a professional quality video production studio designed to capture and record screen...activity in real time. With this video recording software you can capture the moving action...your computer screen and save it as a video file all in a matter of minutes. Screen...capture and video recording provide an excellent training tool to share your computer knowledge, company information, demonstrate..
 
real timesoftwarerecordrecordingscreenrecorderfreecaptureactivityvideo
CaptureWizPro Screen Capture

Shareware by PixelMetrics
43 x 3879Kb downloads

Free Vista Files award
...CaptureWizPro gives you the power to capture it all - screen images, oversize scrolling areas,...screen action, video and audio. Innovative features, like its handy pop-out...No longer just a luxury for documentation specialists, CaptureWizPro enables everyone to capture whatever they want from...and paste anything on your screen - from video presentations to PDF documents, treasure maps to computer...and email it to tech support.
 
videoutilityscreen copytoolscreen capturewindowsaudioscreenshotscreen printprint screen