1 2 3 4 5 6 7 8 9 10 11 12 13 14 15

Sort by : ReleasedNameDownloadsAddedRatingRelevance
TechnoRiverStudio Community Edition

Freeware by TechnoRiver Pte Ltd
86 x 34266Kb downloads

...TechnoRiverStudio. It provides powerful features like WYSIWYG design, Image Acquisition, Image/Vector graphics, Rich Text, Circular Text, Advanced...capable of rendering them into a series of image files in JPG, PNG or TIFF format. To...
mailing addressfree label softwarebusiness cardlabel printingbarcodelabel maker
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...Eye is a fast - and free - image viewer with a nice clean user interface. Feature...high-lights: - The only image viewer you need for viewing and browsing images....menus and toolbars wasting desktop space. - Uncompromising image quality. - Small and very fast, highly tuned...code. - Reads all common image file formats. - Image index feature with very...read finish. - Speculative decoding & caching of images in the background.
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Raster To Vector Converter

Freeware by S&G Team
108 x 10223Kb downloads

...Raster To Vector converter is the most powerful and absolutely free...solution for digitizing vector data from image sources. It combines the power of outline vectorizing...and many other. You can use Raster To Vector PlugIn to process charts, drawings, maps, schemes and...other similar images. Palette and True Color images are supported in BMP, JPG and GIF formats....Raster to vector conversion process is fully automatic and needs no...
Macromedia Flash Player

Freeware by Macromedia
247 x 926Kb downloads

Free Vista Files award
...radial gradient and stroke enhancements. Dynamically import additional image formats: GIF, Progressive JPEG and PNG. Back to...Performance Improve rendering performance through more efficient, cached vector graphics. Enjoy performance boosts for frequently-used features such...
DrawPad Graphic Editor Free

Freeware by NCH Software
13 x 571Kb downloads

...and Create Graphic Images. DrawPad is an easy-to-use image composition and manipulation program, and an essential tool...DrawPad features pencil and brush tools, raster and vector images, image layers for non-destructive editing, and effects...sketching and painting *Work with both raster and vector images *Image layers allow for non-destructive editing *Add effects...
drawingeditcreategraphicsgraphic image editorpaintdrawing softwareimagesgraphic editorfreeeditingsketchpaintingsketchingdesign

Freeware by Zhenzhou Wang
88 x 2640Kb downloads

...Transformation tools including rotate,scale,shear,perspective,flip,and wrap. Auto antialias supported. Image Morphing supported. With this technique, you can create...sequence of intermediate frames that seamlessly transform one image to another and generate output in a form...of gif animation or image file sequence. Gradient Fill tools include linear,radial,square,conical(symmetric),conical(asymmetric) and...
freewaremorphlayerpathscreen captureimage editor
Algolab Photo Vector

Shareware by AlgoLab
63 x 1796Kb downloads

Free Vista Files award
...Vectorizer and image cleaner: a proven handy tool for designers and...professionals to cleanup, reduce number of colors and vectorize images. Converts JPEG, BMP files to EMF, WMF,...DXF. The vectorizer is compatible with Jasc Paint Shop Pro, Adobe...and other materials as well as to create vector graphics for WEB. For stunning photo effects visit...the art gallery Photo Impressionism. AlgoLab Photo Vector is easy to use, fast and precise. By.

Freeware by Virtual Mechanics Inc.
41 x 4967696Kb downloads

Free Vista Files award
...checker and link editor, built-in graphics creation and image editing, enhanced page layout including a snap-to grid...\`Gather\` facility will ensure that all your referenced images and files are automatically transferred. Features: 1. WYSIWYG...for entering Formatted Text, Titles and Code. 5. Vector editor for rectangles, ellipses, pie shapes and polygons....
Project5 Photocut Processor

Demo by George Harder`s Centre
50 x 1169Kb downloads

...Photocut Processor is a bitmap tracer (raster to vector conversion program) that produces realistic photographic effect in...vinyl graphics limitations and produce any continuous tone image (photograph, landscape, etc.) with no additional costs. Project5...of vinyl signmaking with Project5! Photocut Processor creates vector data from bitmap data. This special kind of...bitmap tracing (or vectorization) creates vector that looks like photograph.
vectorsignmakingtracingrasterletteringvinyl cuttersign makingbitmapraster vectorvinyl decalsbitmap tracer

Shareware by RKD Software
36 x 1118Kb downloads

...helps to ensure exceptional reliability. The internal barcode image is of the vector graphics type so that...

Shareware by VextraSoft
37 x 3046Kb downloads

Free Vista Files award
...Vextractor is a vectorizer program for transforming raster images into vector formats by building centerlines and outlines....This tool could be used for the vectorizing photo, logotypes and other line art images for...use in Vector Graphics Design software. You can also vectorize charts,...PBM, PGM, PPM, WBMP, ICO; Output format for vector information: AutoCAD DXF, DXB, HPGL, WMF, EMF, ArcView...
vectorvectorizingoutlineconvertvectorizationpolylineconversioncadimagetiffscanvectorizetracecenterlinedigitizejpeggifimage vectorraster vectorbmpjpgvectoriser2vdigitizinggisautocaddxf
Manco Shapefile Editor

Shareware by Manco Software
12 x 6288Kb downloads

...of direct creation of the shapefiles from the image files by image processing algorithms. This product is...of shapes (.shp) almost just like in any vector graphic editor. Also adding multiple images as backgrounds...In the “Segmentation” tab you can export your image files into the shapefiles. You need to open...“Process Image” button. It will be refined by image processing algorithms. Then you can observe the resulting...
Sothink SWF Quicker

Shareware by SourceTec Software
12 x 19692Kb downloads

...drawing tools, you can also import other popular vector formats including AI, SVG and WMF/EMF and use...the software. As known, it provides the same vector editing capability as Adobe Flash does but costs...and Slide Show. 4. Powerful Flash Creation & Vector Drawing Tools (1) Provides Flash Creation function like...Alignment to align objects. (3) Full set of vector drawing tools, such as Rectangle, Pen, Brush, Eraser,...
flash creatorflash makeranimation makerswf editorflash builderhtml5 animation makeranimation creatorbuild flashmake flashflash editorcreate flashmake animationmake html5 animationflash software
Sothink Glanda

Shareware by SourceTec Software
25 x 26290Kb downloads

Free Vista Files award
...are provided for you to draw and edit vector arts in the way of What You See...Is What You Get. The supported image formats are: *.bmp, *.jpg, *.png, *.gif, etc.; the...
album creatorflash animation softwarebuttons creatorbanners creatorflash buttonscool text effectslideshowflash albums makerflash bannerstext animation
EximiousSoft GIF Creator

Shareware by EximiousSoft
206 x 9064Kb downloads

Free Vista Files award
...needs. EximiousSoft Gif Creator has strong support to vector graphics. You can use it drawing out excellent...a great deal of different animation formats and image formats. Such as GIF,AVI,BMP,PCX,JPG,TIFF,PNG,T GA,PSD,ICO, CUR,ANI, SWF etc....
gif toolsanimated gif editorgif animationsimage editingimagesanimation makersoftwarecreate bannergif imagesanimated gifscreate gifgif creatorgif animatoranimated gif creatorgif converter
Advanced PDF to HTML converter

Shareware by IntraPDF
29 x 2935Kb downloads

...an added option which merges image, creating one image file per page with improved support for Western...and Central European characters. Vector drawing processing has also been enhanced. The converter...
CoffeeCup Animation Studio

Shareware by CoffeeCup Software
54 x 4608Kb downloads

Free Vista Files award
...demand the attention that your website deserves. Add images to build brand new animations, or open an...animated image you already own to edit each frame and...of file types, you can turn practically any image you own into an animation - but it`s...gives you ultimate freedom. Creating frames with this vector format is a breeze and looks so professional...how you did it. There`s even a built-in image editor that features drawing and selection tools to...
web image studiobmpthumbnailanimationjpgeditorbitmapgifimportanimatewifexport
Free Vista Files award
...work; draw your storyboards with both natural-media and vector tools; import or copy and paste text and...and export to AVI, HTML, WAVE or sequential image files for review or integration with other applications....
storyboardanimation planningvideo productionoutlineanimaticoutliningscreenwritingmultimedia planningfilm productionmovie productionscript
Any to Icon

Shareware by Aha-Soft
28 x 5874Kb downloads

Free Vista Files award
...conversion wizard to produce multi-resolution Windows icons from images and Mac OS icons. Images may come in...Any to Icon Pro supports drag-and-drop for adding image files from Windows Explorer with a mouse. Any...to to Icon can convert AI, PDF, SVG vector files to Windows icons also....

Shareware by Sybrex Systems LTD.
19 x 6703Kb downloads

...a file on a disk. Create new text, vector art and images. Quick image embedding for TIFF,...actions support Lot of the annotations support EMF images parsing The VersyPDF Library do not require any...