1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
eXpress IP Locator

Freeware by Irnis I.Haliullin
22 x 501Kb downloads

...Small freeware utility for offline retrieving the country information from IP-address or hostname, viewing IP-address blocks allocated for specified countries and seeking the country by code or code...
 
geolocationaddressgeoipwhoiscountry
Text File Workshop

Freeware by SEONote.info
23 x 1960Kb downloads

...Work with text...
 
utilitestext file
...Collection various time-date utilites for desktop. Collection includes: original digital desktop clock,...
 
transparentdesktopcountdownclockcalendar
SmartScanner

Freeware by SmartSoftware
43 x 1812Kb downloads

...and error-free. It combines all of the SmartSoftware utilites power into a single one-button interface for the...
 
win98winmedvd fixersystemregistry fixerhard drive fixerwindows2003windows2000download windows system fixererror removerwindows fixerfault fixerwinxpsmartfixer 2006error fixercomputer fixerhistory eraser
Hidden Utilities

Shareware by Camtech 2000
9 x 1038Kb downloads

...Hidden Utilities provides easy access to over 200 utilities that are not easily accessible to the user. System information, diagnostics, repair tools and more in both Windows and Command Line...
 
utilitescommandvistahiddendos
AL Font Installer

Shareware by AL-Software Team
30 x 800Kb downloads

...This program is addition to the control panel Windows Fonts. It provides more convenient way for installing a new fonts on your computer. With the help of this program you...
 
utilitesfontfontscontrol panelfont installer
SmartFixer 2007

Shareware by SmartSoftware
6 x 1810Kb downloads

...and error-free. It combines all of the SmartSoftware utilites power into a single one-button interface for the...
 
registry fixerdownload windows system fixererror removercomputer fixerhistory eraserfault fixerwinmedvd fixerwinxpwindows2000hard drive fixerwindows2003smartfixer 2007error fixerwindows fixerwin98
...The Virtual Fader Master is a MIDI Control Program written for Windows XP using the latest in software design and programming techniques. Inspired by the legendary J.L. Cooper Fader...
 
xycontrollermidiutilitesfader
...CAS BACnet Explorer is the perfect utility for exploring, testing and debugging BACnet networks and devices. * Exploring - Automatically discover all the BACnet® IP, BACnet® Ethernet and BACnet MSTP devices, objects,...
 
ethernetindustrialutilitesbuildingtoolsmstpsoftwaresmartautomationbacnet
ABF Internet Explorer Tools

Shareware by ABF software, Inc.
14 x 1094Kb downloads

Free Vista Files award
...ABF Internet Explorer Tools is a set of very useful plug-ins for the popular MS Internet Explorer browser. The software contains a tool bar, page browser, magnifier bar, and...
 
toolsblockabfexplorermagnifiermagnifyimagessavewindowsinternetrefreshbrowserutilitespop-ups
Foxy Admin

Shareware by DemiWare Inc.
1 x 12163Kb downloads

...Domain computers, users manager based on Active Directory, WMI. It is intended for use system administrators or other IT personnel to keep control of the local network with users` computers...
 
wmiremote accessadmin toolsremote controlactive directoryinventorypinglanvncfast pingwindowsmultithreadedutilitesmulti-threadedmultithreaded pingdomaimmulti-threaded ping
SystemCop

Shareware by Mahaon soft
7 x 1151Kb downloads

...SystemCop is a universal, flexible and powerful tool for tuning and optimizating the work of the Windows operating systems. SystemCop allows you to change a great number of standard and...
 
startuputilitesexplorerstart menumahaon softcustomizetunesoftwaretweakoptimizedesktopnetworksystemcopautorun
Amelix FCP

Shareware by Amelix.com
13 x 850Kb downloads

...Amelix FCP allows for the power encryption and decryption of all your personal files. Encrypt and decrypt files of any type. This is symmetric-key cryptography program. Amelix File Cryptor...
 
cryptorcryptography utilitesdecodeprotectcodingprivaciinformationpassworddecodingpaswordamelixcom
Free Vista Files award
...It`s a fact! Over time, all PCs become cluttered with unnecessary Internet files and invalid entries are injected into system registry. If not maintained, computer performance significantly deteriorates over...
 
cleansystem utilitesoptimizationinternetregistry
MyLife Smart Organizer Suite 5 user

Shareware by PowerHouse Software Co.
15 x 187295Kb downloads

...MYLIFE Smart Organizer Suite is a comprehensive suite of Personal organization & record keeping programs for your Digital Lifestyle. This ultimate Swiss knife of SW suite has over 90 programs covering...
 
smart organizerparty plannermusic collectionsschool plannerpersonal info mgrrecipesphoto albumwin utilitieshome mgmtpersonal finance
...MYLIFE Smart Organizer Suite is a comprehensive suite of Personal organization & record keeping programs for your Digital Lifestyle. This ultimate Swiss knife of SW suite has over 90 programs covering...
 
party plannersmart organizerrecipesmusic collectionspersonal info mgrpersonal financephoto albumwin utilitiesschool plannerhome mgmt
...scanner, email, slideshows, Photo frames, calendars, postcards, file utilites etc. This program will help people catalog all...
 
label tag picturesslideshowsphoto databasepicture vieweralbumphoto editorpicture web pagespicture file utilitiespresentationsphoto catalog
MyLife Photo Album & Editor Suite 5 user

Shareware by PowerHouse Software Co.
21 x 127002Kb downloads

...scanner, email, slideshows, Photo frames, calendars, postcards, file utilites etc. This program will help people catalog all...
 
label tag picturesphoto databasepicture vieweralbumphoto editorslideshowspicture file utilitiespresentationspicture web pagesphoto catalog