Sort by : ReleasedNameDownloadsAddedRatingRelevance
Scannet Pro

Shareware by Profiler3d
295 x 11118Kb downloads

...giving object, type, local name and Network-term.The module checks in individual programmable timeperiods the complete workinggroup in...module tests the security behavior of SMTP servers, checks a possible authentification and also the delivery of...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...mailbox, and runs in the background. It can check your mailbox and parse through messages looking for...and leave unmatched email in your mailbox to check personally. As part of the free Mach5 Mailer...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...keywords again. The webmasters tool is able to check MSN, Yahoo and Google for the amount of...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
Link200

Freeware by Veign
78 x 1615Kb downloads

Free Vista Files award
...is no longer valid. Link200 will handle the checking and cleaning. Users can automatically delete the bad...
 
validfavoritesinternetcheckfirefoxnetscapeclean
Kingdia DVD to AVI/VCD/SVCD Ripper

Shareware by Kingdia Software Inc
167 x 1285Kb downloads

...AVI/VCD/SVCD Ripper supports batch file processing. You can check the chapters or videos you want to convert...
 
dvd mpegkingdia dvd ripperdvd divx ripperdvd mpeg ripperdvd vcddvd vcd ripperdvd avidvd svcd ripperdvd ripper softwarekingdia softwaresmartdvd avi ripper
...Password Assistant a complete solution to check your current passwords & generate new, strong passwords....
 
loginutilitieswindows securityhackersgeneratedown loadhome networksharewaregeneratorhackingpasswordsprivacysecurefreewareutilitydownloadsdownload software
...corrective recommendations and easy remedies for Windows systems. Check & correct unset or blank passwords, prevent unauthorized...
 
system checksystem vulnerabilitiessystem securitysecuritychecksecurity settingssystem correctionssecure computer
AliveMon

Shareware by Adiscon GmbH
58 x 6636Kb downloads

Free Vista Files award
...actions by auto-starting programs. Application-specific probes let you check the actual status of your application (like web...Save a lot of time: no more periodic checking necessary. Simply configure AliveMon and forget about it....
 
serveravailabilitymonitoring
Cayman Browser

Freeware by caymanbrowser.com
77 x 1677Kb downloads

...flash ads just by a click *Website scan: Check all Urls in a web page and show...
 
webbrowser
SID DVD-Video Image Extractor

Freeware by SoundInDepth.com
48 x 12128Kb downloads

...on how you set your options), you may check the checkbox shown in this dialog to use...
 
rewindpauseturningmillisecondssingle snapshotonoffaudiodvd-videocontinuous snapshotssequencetimed snapshotsstopimagescapturefast forwardportionplayextractor
CatsCradle

Shareware by Stormdance
67 x 1379Kb downloads

Free Vista Files award
...leaving all the sensitive HTML code untouched. To check all`s going smoothly you can instantly preview your...
 
localisingwebtranslatortranslatingcatscradletranslationlocalizationlocalisationlocalizingweb pageweb page editorhtml
Ezilon Toolbar

Freeware by Ezilon Directory
57 x 239Kb downloads

...how the website looks way back), ability to check images, world news search and also the ability...sign up and check your own free email. It contains major functions...
 
image search toolbaralexa tool barspop blockerpop stoppersearch engine toolbars

Freeware by Miraplacid
71 x 824Kb downloads

Free Vista Files award
...MSCExec allows you to call OS command or launch an application right from your script. You can set...
 
activexasp componentchilisoftfreewarejavascriptvisual basicvbscriptspicescripting hostchiliaspiissharewarecomponentslinux
...Zune Converter supports batch file processing. You can check the chapters or videos you want to convert...
 
zune videodvd zunemircosoft zune
Nesox Link Checker Free Edition

Freeware by Nesox Solutions
69 x 911Kb downloads

...Nesox Link Checker is a professional web link validator and bulk...page rank, traffic rank checker software for webmasters. It could help you load...verifying and validating for broken links, it also checks the link popularity (Google Page Rank) for unlimited...
 
link popularity softwaretraffic rank checklink checker softwarelink validatepagerank checkerlink popularity checklink parserpagerank softwarelink brokenlink validator softwaretraffic rank software
Subscribe Emails

Freeware by IM-Soft
73 x 609Kb downloads

Free Vista Files award
...mailing lists on Internet websites. It lets you check POP3 email mailboxes for subscribe or unsubscribe email...
 
mailingmassemailaddresse-mailfreemailerbomberremailerbulksmtpbook
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...least, a built-in validation tool allows you to check your code using W3C standards for perfectly valid...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
DipTrace Free

Freeware by Novarm, Ltd.
97 x 95857Kb downloads

...is available. Other important features are Electrical Rule Check (ERC), Design Rule Check (DRC and Online DRC)...and Net Connectivity Check - the functions that check connections in Schematic by different rules (pin type,...
 
pcb softwareelectronicsschematic captureecadpcb layoutpcb design software
SEOSmart Future PR

Freeware by Recovery-Review.com
67 x 464Kb downloads

...SEOSmart Future PR checks 94 Google data centers to obtain your Web...Web sites with inflated or dropping ratings by checking the site`s PageRank value with multiple data centers....PR, you are just one click away from checking the domain`s PageRank value over 94 different Google...has to offer? Add or modify data centers` URLs or IP addresses at any time by simply...logs.
 
recovery reviewproxysearch engine optimisationpagerank checkerpromotealexafuture pagerankgoogle ranksserptoolsseochataverage pagerank
Simple Currency Converter

Freeware by OnlineFinancialSite
82 x 343Kb downloads

...This simple currency calculator instantly converts base world currencies and updates exchange rates with a single button click. Cross currency exchange rates are based on US dollar rate. Edit, copy,...
 
dollarforexeurocurrencyfreepoundmarkcalculatorforeign exchangecheckconverterratestravelerfrankyencurrencies