1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21

Sort by : ReleasedNameDownloadsAddedRatingRelevance
GroupMail :: Free Edition

Freeware by Infacta Ltd
107 x 13299Kb downloads

Free Vista Files award
...This group email software and marketing solution takes the time and effort out of sending...
 
bulk mailerfree html email templatesnewsletter softwarefree group email softwaregroup maillist management softwaregroupmailbulk email softwareemail marketing softwareemail newslettersmass email software
Advanced Time Reports Personal

Freeware by Xpress Software Inc.
27 x 6830Kb downloads

...Advanced Time Reports Personal Edition is an intuitive time tracking & project management solution that will help...businesses worldwide to perform essential functions such as timesheet reporting and project management. Advanced Time Reports Personal...so you can get paid faster. Manage your time more efficiently by recording projects and tasks and...estimate.
 
timekeepingtask trackingtime allocationproject recordingtime recordingtimesheetstime managementtime keepingclient trackingtask managementproject trackingtime trackingcustomer trackingproject management
StudioLine Photo Basic

Freeware by H&M System Software GmbH
150 x 48284Kb downloads

Free Vista Files award
...StudioLine Photo Basic 4 is a free image management and editing solution. A load assistant guides you...
 
geotaggingimage editingprintimage batch processingarchivingimage management
Download Accelerator Plus

Freeware by Speedbit LTD.
521 x 912Kb downloads

Free Vista Files award
...to the fastest possible speed. DAP provides file management tools that allow you to download efficiently and...The new DAPsters Manager feature offers a one-click solution for downloading from hosting sites such as RapidShare...
 
speedbitsecureinternetdownload accelerator plusfacebook downloadervideo downloadorbitdapidmdownload managerfastgetrightoptimizeprivacyconverterstreamingweb acceleratorfree
Backup2Net

Freeware by Armia Systems, Inc
36 x 1000Kb downloads

...Offers online and offline scheduled backup and recovery solutions which allow users to automatically store critical data...in home use, system administration, web mastering, project management etc to mention a few. Backup2Net is a...complete solution for your specific backup requirements. Now you may...computer connected to the internet. Using our backup Solution requires that you have the Backup2Net executable (download...
 
computerserverwebfilefreescheduledinternetdrivebackupoffsiteonline
...detects available networks and automates the creation and management of connection settings. Allows laptop users seamless migration...user to create and save a profile each time a connection to a new network is made....
 
laptop mobile internet accesswireless networking solutionwireless networking softwarenetwork connectivityautomatic network connectioninternet connectivitynetwork access software
...a centralized interface for contact management, customer service, time tracking, and electronic communication. Radix includes several sophisticated...and fully integrated modules: Help Desk, Knowledge Base, Time Tracking, Contact Management, Email Client, Appointment Scheduling, Project...at home. Radix is a powerful and affordable solution for businesses that need an integrated approach for...
 
crmcontact managementclient invoicingpimappointment schedulingtime trackingexpense trackingknowledge basehelp desk
...have come a long way from primitive file management tools to sophisticated home and office computing environments...want in congested Taskbar environment. SwitchWindow, a freeware solution by Rocata Software, is here to help us....documents and applications without having to waste precious time on searching for the desired window! As we...
 
windowclosemenuswitchcontext
Frigate3Lite

Freeware by Helmsman
47 x 5200Kb downloads

...biggest programming mistake ever made – an ill-thought solution called Windows Explorer, you are wasting your time...Frigate 3 offers extensive network and FTP file management features along with powerful ‘search and replace’ functions...
 
directoryfile manageftparchiveexplorerfolder
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...over 20 file types, PictureViewer .EXE is your solution for anything from professional presentations to idle image...provides a comprehensive slideshow utility supporting auto-play, custom time intervals, forward, reverse and random play orders. With...custom playlists or thumbnail images. Image editing and management features allow you to rotate, resize, print, delete,...browsing for images, displaying family photographs or making multimedia presentations,...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
TFTP Server

Freeware by SolarWinds
1310 x 6252Kb downloads

...Server is the most robust, widely-trusted and, easy-to-use solution that helps network engineers with projects ranging from...multiple network devices. This powerful feature saves valuable time when managing a complex network with many devices....
 
networkpingfreetoolsfirmwaresubnettftpsolarwindsciscotracerouteserverimageaddress
1 Absolutely FreeTime

Freeware by Timewatch plc
40 x 29387Kb downloads

...Freeware version of Time(r), the Time Recording, Billing, Costing and Project Management Solution from...Timewatch. With FreeTime, you can record time and expenses, analyze costs, invoice your customers and...generate Reports. FreeTime integrates with MS-Word 97-2000 to produce Invoices, includes...data, as well as the Crystal Reports V8.X runtime which is built in to provide you a...Word, Excel, Email etc.
 
time recordingtime trackinginvoivingbillingtime writingcostingproject management
TERAVoice Server

Freeware by TERASENS GmbH
68 x 84670Kb downloads

...and managed waiting queues and create custom IVR solutions in order to cut down cost for call...agents. With its MMC-based management console, TERAVoice can be administered and monitored easily,...board into your file-server and get your telephony solution started at very low cost, while maintaining scaleability...Flexibility TERAVoice combines the ease-of-use of simple voicemail solutions and the flexibility of programmable systems. Voice mailboxes,...
 
telephonypstnpbxtapiservergatekeepervbscriptsmsvoipteravoicemodemivrgatewayvoicemailbridgejavascriptmwidialogich323isdn
Advanced Time Reports Web Personal

Freeware by Xpress Software Inc.
22 x 1328Kb downloads

...Advanced Time Reports Personal Edition is an intuitive time tracking & project management solution that will help...businesses worldwide to perform essential functions such as timesheet reporting and project management. Advanced Time Reports Personal...so you can get paid faster. Manage your time more efficiently by recording projects and tasks and...estimate.
 
time managementproject trackingtime allocationtimekeepingproject recordingproject managementtask trackingclient trackingtime trackingtime keepingtask managementcustomer trackingtimesheetstime recording
...Free web based software development project management with time clock and attendants, issue management, templates and powerful...project management tools. The system is modular, you can, aside...following optional modules: Gantt diagram and planning, approval management and test management. The system is designed to...be able to plan projects, track all the time spent on all projects down to task level,...
 
enterpriseprojectmanagementsdknon-billableganttdiagramtrackingwebplanninginternetxml
Easy Time Tracking

Freeware by Logic Software, Inc.
51 x 6838Kb downloads

Free Vista Files award
...Easy Time Tracking is a powerful, yet extremely easy-to-use time...and customer billing application. It is an ideal solution for those individual contractors and companies who need...to know readily how much time is spent on their tasks and how many...track expenses they incur. Your business needs Easy Time Tracking if it is essential that you track...People who will benefit greatly from using Easy Time Tracking include: Software Developers, Web...
 
time management applicationtimingtimerexpensetask timingtimesheet softwareinvoicingmanage projects and tasksbilling softwarebillable hourscustomer billingexpense trackingtime tracking
Datashake desktop

Freeware by Datashake
19 x 2260Kb downloads

...Datashake is a desktop search interface solution that plugs into any existing desktop search software...a well developed artificial intelligence sequence used every time the application is run (e.g. unique algorithms for...measuring file usage clicking and access time patterns). C) Unlike other desktop search applications, even...
 
msn desktop searchdownloadsfile management systemrecently used filesfreewarefile management softwaremrufile searchsharewarefree stuffwindowsfile management utilityexplorer
ManageEngine ADManager Plus

Shareware by ZOHO Corp.
46 x 36864Kb downloads

...is a wholesome yet simple-to-use, web-based Active Directory management solution that makes day-to-day AD management immensely easy....to AD Administrators. Administrators can evevn perform AD management actions right from the reports. All these reports...tasks and their time-based follow-up tasks, AD request management system and a mini compliance toolkit – ADManager...
 
active directory workflowpassword managementactive directory automationsecurity delegationreport active directory usersexchange managementwindows network managementlogon reportsbulk user management
...Eunovation Technology provides its own synchronization and data management software so you can easily bring your personal...environment with you. With "Taango" ,the latest mobile solution from Eunovation Technology, no matter where you go,...Taango can synchronize your files and emails by time or any conditions. Virtual Computer: Taango store your...
 
freeware
PDF Security OwnerGuard

Freeware by Armjisoft DRM Systems
25 x 9028Kb downloads

...Security OwnerGuard is the ultimate Security, Digital Rights Management (DRM), Copy Protection, Watermarking, Licensing and Distribution Management...screen capture, save, copy, expiration date and working time for your users. PDF Security OwnerGuard Minimizes your...
 
rights managementpdf securitydigital rights managementpublishingcopy protectioncopyright protectionprevent printencryptioncontrolebookswatermarkingstop copyingpdf drmlicensing