1 2 3 4 5 6 7 8 9 ... 84 85 86 87 88 89 90 91 92 93

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Photo Gadget Viewer

Freeware by XemiComputers Ltd.
364 x 864Kb downloads

Free Vista Files award
...Photo Gadget Viewer is a free to use program for Windows made for browsing through digital photos. It is fast in opening a photo file and offers standard keyboard shortcuts...
 
view thumbsview picturesshow thumbsphoto gadget viewerbrowse imagesview photosshow photosshow thumbnailsshow imagesview imagesdisplay photosview thumbnailsshow picturesxemicomputersdisplay pictures
Photo Resize Magic

Freeware by SOW
379 x 582Kb downloads

...Photo Resize Magic is a useful and easy-to-use tool for digital camera owners. This free software allows you to resize and convert your digital photos. You can convert...
 
convertdigital photojpegtiffjpgconversionphoto resizer
Print Conductor

Freeware by fCoder Group, Inc.
61 x 13359Kb downloads

...Print Conductor is batch printing software. If you regularly have to open and print a large number of files, this elegant tool can be a real timesaver. Manually printing several...
 
printingbatch file printingbatch printxlsautomationbatch document printingdxfdocumentsbatch printingcadbatch pdf printingvsddwgautomate
...other feature restrictions, etc. Looking for a faster TIFF or PDF viewer - give Brava! Reader a...
 
free viewerimage viewerpdf viewertiff viewer
FirmTools ShellExtension

Freeware by FirmTools
90 x 520Kb downloads

...ShellExtension is a real handy freebie for Windows users. Install this tool and it will add three new options to your menu when you right click on a picture file:...
 
picture filecontext menuquick convertthumbnail preview
...Tiff counter is an easy to use Tiff page count application. It supports all versions of...single and multi-page tiff files. Tiff counter also support tiff files which is compressed....Tiff counter also the known to be fastest tiff counting application for windows. We have tested Tiff...counter with 60000+ tiff pages. Working with Tiff counter to count your tiff files is very...easy.
 
tif page countcounting tiff filestif countercount tiff filestiff countercount tiff pages
WinFax Merger

Freeware by sfaxtools studio
512 x 447Kb downloads

...that your multiple-page fax are in separate multiple tiff (or pdf) files, not all pages in one...WinFax users. When you convert your winfax to tiff (or pdf) files by format conversion tools, you...that your multiple-page fax are in separate multiple tiff (or pdf) files, not all pages in one...
 
fxd fxr fxsfxmwinfax faxmerger combinermerge combine
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...3DBrowser Light Edition (x32/x64 bits) is a browser for your 3D, photo, video and audio files. This is a fast and powerful media manager to browse thousands of files...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
Falco Image Studio

Freeware by Falco Software Company
61 x 23301Kb downloads

...Falco Image Editor is a Graphics Tool to create, edit and export images. Create professional looking images with ease. Key features: 1. Loading from BMP, GIF, PNG, JPG, PSD(Photoshop),...
 
image studiofalco image editorfalco image studio
TechnoRiverStudio Community Edition

Freeware by TechnoRiver Pte Ltd
86 x 34266Kb downloads

...series of image files in JPG, PNG or TIFF format. To assist in the design of labels,TechnoRiverStudio...
 
mailing addressfree label softwarebusiness cardlabel printingbarcodelabel maker
...unique tool to combine several single and multi-page tiff files into one multi-page tiff file. Tiff combiner...has easy to use interface to combine tiff files. It has fast tiff file search facility...to facilitate your work. We have design Tiff combiner considering Fast and error free combining of...your tiff files. It supports all versions of tiff files. It also supports tiff files which are...compressed.
 
merge tif filestif mergertiff mergertiff combinercombine tif filestif combinermerge tiff filecombine tiff files
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...Image Eye is a fast - and free - image viewer with a nice clean user interface. Feature high-lights: - The only image viewer you need for viewing and browsing images. - Clean...
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Photomania Deluxe

Freeware by COSMOTEK
88 x 2033Kb downloads

...Photomania is a comprehensive application ideal for acquiring, organizing, viewing, enhancing, and sharing your images. A full-featured image viewer quickly generates high-quality displays of your images. Photomania supports...
 
adatiffpnggraphic skintgamngimage vieweralpha blendingxpmjpeg2000bmp32bit picturewmfemfgifrasimage enhancerphotomaniapcx
Kimmie Album

Freeware by Ace Zip Soft.
51 x 3690Kb downloads

...It can turn your images into a flash style music album of a index.htm and a index.swf files by a few clicks. It supports images...
 
digital photo albumflash albumweb photo albumweb albummusic albumonline photo albumbaby photo albumfamily photo albumphoto album softwarefree online photo albumpersonalized photo album
Free Vista Files award
...- Graphical user interface (GUI) routines based on Motif and Windows API functions. - Manuals are available...
 
scientificplottingprogramminglibrary
Free Vista Files award
...- Graphical user interface (GUI) routines based on Motif and Windows API functions. - Manuals are available...
 
scientificplottinglibraryprogramming
Free Vista Files award
...- Graphical user interface (GUI) routines based on Motif and Windows API functions. - Manuals are available...
 
scientificplottingprogramminglibrary
Free Vista Files award
...- Graphical user interface (GUI) routines based on Motif and Windows API functions. - Manuals are available...
 
libraryscientificprogrammingplotting
Free Vista Files award
...- Graphical user interface (GUI) routines based on Motif and Windows API functions. - Manuals are available...
 
libraryprogrammingscientificplotting
Free Vista Files award
...- Graphical user interface (GUI) routines based on Motif and Windows API functions. - English manuals in...
 
programmingplottingscientific