1 2 3 4 5 6 7 8 9 10

Sort by : ReleasedNameDownloadsAddedRatingRelevance
AudioShell

Freeware by Softpointer Inc
451 x 2503Kb downloads

Free Vista Files award
...Explorer shell extension plug-in which allows you to view and edit ID3 meta-data tags directly in Windows...music tags information into Windows Explorer columns and Preview pane, thumbnail handler add thumbnails with album art...
 
ape shell extensionmp4 shell extensionipod shell extensionogg shell extensionmp3 shell extensionwma shell extension
...technical skills. Catalog contain power search, categorized navigation, thumbnail viewing, selection basket, products description pages, powerful slide...show, product detail section, special view graphics, magnified view, graphic zooming option and many...
 
free slide show builderfree catalog builderfree catalog softwarefree photo album softwarefree web catalog makerfree catalog maker
Mihov Picture Downloader

Freeware by Miha Psenica
93 x 376Kb downloads

...hard drive, without clicking on every link and viewing every thumbnail. You can also view the images...
 
mihov picture downloadervideophotosmusicquickpageaudiothumbnailslistslikaminiimagespicturesinternetspletgraphicsfotoweblinked
...VBA Code Compare gives you a chance to view the comparison report in two side-by-side windows, and...differences down to the level of characters - Thumbnail View for graphical presentation of differences Editing: - Synchronization...
 
mergefilevisualexceldocumentmodulebasicsourcevbacompareutilitycodesoftwaredifferenceprojectsheetmacrosversionsynchronizetool
3DBrowser Light Edition

Shareware by Mootools
121 x 51078Kb downloads

Free Vista Files award
...to browse thousands of files thanks to its thumbnails window. You’ll find user friendly features to display...>> Display your files the way you want: View your whole photos library thanks to the multi-folders...browsing capabilities. A customizable display mode allows viewing the information you need such the width and...
 
skpprintvieworganizeplyxsiaudiobrowselxoeditjpeglwothumbnail3dsobjdxfdaeconvertscenecobanimatedmp3imagecolladagifmaxlightwave
Windows File Explorer

Freeware by FreeSoft Labs
86 x 2640Kb downloads

...that Microsoft`s Windows Explorer is missing like image preview and it has two fixed file views side...added to Windows File Explorer menus too. Support Thumbnail views of images. Supports Drag & Drop with the...(if supported by OS) Built in image file viewer (supports bmp, jpeg, png, gif, tiff, pcx, pbm,...
 
viewerutilitypowerdeskwindowsnortonsalamandersystemzipexplorermanagerthumbnailbrowsercomandercommanderfilemanager
602PC SUITE

Shareware by Software602, Inc.
61 x 28195Kb downloads

....PSD). 602Album is a digital photo album with thumbnail view, slideshow, enhanced photo printing, batch photo resize...
 
digital imagingknowledgeexcelproductivityeditorworker602prosmall business602softwareoffice suitexlsspreadsheetfree downloadopenofficesoftware602602textphotoprocessordocumentalternativemicrosoft word

Freeware by Pawsoft
35 x 1253Kb downloads

...for both main dialog and file browser, new thumbnail browing mode, favorites folders system complete with favorites...management (move, delete, rename and copy file), multiple view modes including tiled view, many options for customisation,...
 
metafiledigicamimagecameradeletecapturezoomgrabcopybitmapmanagerviewjpegformatcustomcursorbrowserenameedithistorymovegraphicfavoriteicon
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...It has never been easier to view images and pictures on your computer whether your...images. With support for over 20 file types, PictureViewer .EXE is your solution for anything from professional...presentations to idle image browsing. PictureViewer .EXE supports a comprehensive spectrum of image formats,...wpg), providing unrivaled accessibility and flexibility. The integrated MediaView component seamlessly allows you to view images in...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
AhaView Free

Freeware by Aha-soft
55 x 765Kb downloads

Free Vista Files award
...AhaView is a handy image viewer and converter. It displays images in the all...ICO, CUR, ANI, WBMP, PSD. It has a thumbnail mode and you can quickly browse through numerous...
 
converterconvertorviewerpicturegifbitmapjpgfreewarejpegahaviewimagepngwbmp
Advanced Renamer

Freeware by Hulubulu Software
33 x 8231Kb downloads

...photos for both experienced users and beginners. Use thumbnail mode to display thumbnails directly in the file...names. Selected features Unicode Undo functionality Real time preview of renamed file names Regular Expressions MP3/ID3 naming...photo renaming with EXIF support Video file support Thumbnail view Supports both files and folders Several renaming methods...
 
batchchange caseimagephoto renameid3exifreplacejpegmp3timestampjpgthumbnailsinsertmp3 renamenamingaddrenamingrenamerdeleteattributesrename fileregular expressionsregexfile renamechange name
...The initial view of a PDF document can be tweaked. Is...PDF, you are allowed to set the initial view preferences of a PDF document, such as whether...PDF files in full screen mode, outlines mode, thumbnail mode, or simply without any special mode. Page...
 
layoutcompressorpdfhidetweaksettingsmodeinitialsecretviewcompressiontweakpdf
Max Secure Content Audit Enterprise

Public domain by Rachna Pradhan
37 x 3255Kb downloads

...utilized programs (e.g. MS Office) Can generate a thumbnail view of all the images across the network Can...
 
freeware
WildBit Viewer

Freeware by Marko Hietanen
24 x 14873Kb downloads

...WildBit Viewer is compact & fast image viewer with slide show and editor. Eye catching interface...within blazing fast folder, file list and thumbnail viewer. Viewer includes also Image Info with Image...(like PhotoShop file info) from JPEG and TIFF, Thumbview has changeable views, sorting and thumbnail predefined sizes...for fast thumbnail size setting. Viewer also includes shell toolbar, you can drop your...Show List Editor.
 
compactslide showeditorfast image viewer
...Free RAW Viewer is an image viewer with built-in slide show viewer. Designed to support...JPEG, GIF, and BMP. The program offers a thumbnail browser and a full preview of the selected...
 
raw images viewraw slideshowcr2 files viewcanon eos file viewview rawraw photo viewerraw viewerslide show playersram files viewraw thumbnailsphoto slide show softwarefreeware slide showjpg slide show
WinSWF Extractor

Shareware by Dream Soft
42 x 732Kb downloads

...compression. With a simple click WinSWF Extractor lets preview any image or sound resources from your SWF...having to launch any external application! Use the Thumbnail view mode in the to instantly visualize all the...
 
protectionfrom swfedit swfdecompile swfflash decompileswf mp3deprotectextract imagesswf decomplierswf decompileextract mp3flash decompilerextract swf
Free Vista Files award
...flexible DV player and recorder software. You can view your DV tape on your PC! PlayDV gives...VCR. Comparing to other software which limits the viewing area to a tiny thumbnail, PlayDV gives you...work at the same time. You can also view the video in full screen. PlayDV supports hog...
 
firewirecamcorderplaybackilinksoftware1394videorecordminidvplayerview
...a fast high-resolution digital imaging program with a thumbnail browser that allows the user to view, organise,...and many more. Also offering different modes to view the selected image such as full screen or...
 
digital gallerydigital image galleryorganiseimage viewersharpenthumbnail browserdigital imagingnexus imagersmoothsharewareslide showenhanceresizeprint imagesphoto albumimage manipulationcrop
AhaView

Shareware by Aha-Soft
57 x 6154Kb downloads

Free Vista Files award
...AhaView is a handy image viewer and converter for Windows 8/7/Vista/XP/2000/98/95. It displays images...XBM, TGA, SVG, AI, PDF. It has a thumbnail mode and lets you quickly browse through numerous...to the clipboard. Command line interface is available. AhaView is a tool for managing the images on...your computer easily and efficiently. AhaView has a powerful image viewer called Quick View...lets you see your photos almost instantly.
 
gifjpegjpgviewpicturebitmapsvgwbmppngconvertviewerconvertorconverterimagetga
Advanced JPEG Compressor

Demo by WinSoftMagic Inc.
66 x 6215Kb downloads

Free Vista Files award
...and flexible user interface which allows you to view `before and after` pictures. All of the AJC`s...
 
photodigitaloptimizeoptimizingcompressionsmallerjpgconvertoptimizereditortiffcamerathumbnailshrinkbmpgraphicresizejpegreduceoptimizationviewerconverterpictureresizerimageresizingreducer