Sort by : ReleasedNameDownloadsAddedRatingRelevance
Code 128 Barcode Generator

Shareware by I T
22 x 4016Kb downloads

...purposes. Software easily runs with all windows operating system including Windows XP, NT, 98, ME, 2003 server,...
 
pdf 417programdesignercreatetagsbooklandsccfreetoollabelsscannerassetprinterupcsoftwarepagelabelingcode 128barcodeinterleaveisbnribbonsfontstickermaker
IVideoWare DVD to PSP Converter

Shareware by ivideoware.com
2 x 29700Kb downloads

...IVideoWare DVD to PSP Converter is a powerful DVD ripper and video conversion tool, which can help you convert DVD to PSP MP4, MPEG4, H.264/PSP AVC Video, and...
 
psp movie converterdvd psp mp4convert dvd pspdvd movie pspdvd ripperdvd psp converter
DART PRO MT

Shareware by DARTECH, Inc
5 x 5241Kb downloads

...The most advanced audio tools for maximizing sound quality and achieving professional results. Use it to record from any audio source or use with audio files to clean up the...
 
dropoutsdecrackledehumaudio customizerestoreaudio controlaudio cleanupdepopdartdeclicknoise eliminationaudio editingimprove audio qualityde-clickaudio noise reductionaudio masteringdehissaudio restoration
tracks Audio Editor

Freeware by AUDIOTOOLS.WS
7 x 10537Kb downloads

...4-Record from all available audio sources in your system like microphone, Stereo mix, Line in. etc. you...
 
pro audiocar audioaudio fileaudio videomp3youtube audio
DBEXform

Shareware by Willmansoft
2 x 3620Kb downloads

...execute stored procedures from Sql servers or import system classes from Windows or business logic written with...
 
sqloracledatabaseformsmssqlsqlitemakerruntimemysqlchartdevelopmentrelationalreportsdesigneraccessbuilder
MySQL Database Converter

Shareware by Database Migration
1 x 1423Kb downloads

...technical knowledge of database. MySQL to MSSQL database system supports entire properties of MySQL or Microsoft SQL...
 
mysqlsoftwarenormalizationconversionsynchronizationmigratetransferkeytoolprimaryrecordstableconverteruniqueprogramdatabasestore procedureschemarowmssqlnull valueforeignrelationcolumnsindex
RipToo Blu-ray Copy

Shareware by RipToo Studio
2 x 3461Kb downloads

...user-friendly and simple interface and free technical support. System Required Microsoft Windows 2000/XP/Vista/7 Intel or AMD of...
 
copy blu-rayblu-ray copyblu-ray copyingblu-ray copy programback blu-ray

Freeware by vdocapture.com
32 x 4854Kb downloads

...Netcam Watcher Professional is a Digital Video Recorder for Network Cameras that can record from multiple cameras simultaneously.The faster the system, the higher the overall frame rate that you...
 
cameranetwork
X360 Video Converter ActiveX OCX (Twice Developer)

Shareware by X360 Software
5 x 4602Kb downloads

Free Vista Files award
...X360 Video to Avi Converter ActiveX Control helps programmers to playback, split, merge, convert and compress all popular video formats ( 3GP, ASF, DAT (VCD), MOV, MPEG-1, MPEG-2,H....
 
compress aviocxsplit video ocxdivxrmvb wmvmerge video activecutvideo converter activexpageasph264dotnetplaybackvistajoin video sdkmovmpeg-4
DVD Audio Ripper

Shareware by imtoo.com
27 x 9618Kb downloads

...DVD Audio Ripper is a professional software DVD movie soundtrack ripper that can extract movie soundtracks from DVDs and rip DVD audio to MP3/WAV with complete sound effects. It...
 
convert dvd mp3rip dvd audioaudio dvd extractdvd audio ripperdvd wavrip audio from dvd
BB EAP

Shareware by B+B Systems, LLC
9 x 18554Kb downloads

...Client management/Case management - Document, track, follow-up and record actions taken in Employee Assistance Programs. Easier to use than paper case management, with additional reporting and analysis capabilities. Record...
 
providersalcoholclient recordscontactscounselingemployee assistance programeapreferralsdrugcase management
WinPure ListCleaner Pro

Commercial by WinPure
15 x 24249Kb downloads

...details, student names, etc. Without special training or systems knowledge, you can increase business efficiency by transforming...Pro identifies missing data with a simple scoring system and graphs. Complete data in many cases is...
 
list cleanerdata cleansingdata cleaningmarketing list softwarelist cleaninglist managementlist cleansingdedupewinpureemail softwarebusiness software
...is the most luxurious and sophisticated file sharing system you`ll find. It can harness the power of...
 
httpp2ped2kfoxymagmapioletedonkeymagnettorrentpeer-to-peerfile sharingemulegnutellaftpgnutella2bittorrent
Bookmark Buddy

Shareware by Edward Leigh
16 x 699Kb downloads

Free Vista Files award
...a bookmark quickly with the intuitive 3-level filing system - and file in as many categories as...
 
bookmarkscheckencryptmsnexportconvertcompuservebackupbookmark managerfavoritesmozillanetscapeimportaolloginfavorites organizerfavourites organisershortcutslog-in
...service is compatible with all Microsoft windows operating system like windows 98, 2000, 2003, XP (home and...
 
activesyncsoftwaremobilewindowssmspocketbulkcreatesendmessagepdainternationalsupporttoolsmartphonemessaginggroupunicodegloballytextbusinessunlimitedutilitymicrosoftmultilingualmarketing
...corporate domain. Active Directory support allows the IM system getting information about the users directly from the...
 
sipmessengervoipsoftphonechatvideo phoneenterpriseofficecommunicatorfree
Sothink DVD Ripper + EZWorkshop Suite

Shareware by SourceTec Software
21 x 7325Kb downloads

...is small, fast to launch, and uses less system resources than other DVD ripping software and works...
 
dvd ezworkshopcopy dvddvd xviddvd divxconvert dvd softwarempeg dvdshrink dvdvideo dvdrip dvd moviesrip dvd avidvd ripperdvd ripping softwareavi dvd
...and are present in several coordinate and reference systems (Geographic, UTM / WGS84, ETRS89). House Coordinates or...map material. The application scope reaches from information systems over navigation services, geo marketing, telecommunications and UTMS...
 
earthinternationalreferencebuildingshouseutmcodecoordinatehousessearchgoogledistancedatabasekilletsoftproximitygeocorrelationlongitudelatitudewgs84coordinatesnavigationcalculationperipherypostalcodingetrs89
...by creating a virtual camera recognized by the system that can be selected as the video source...
 
videomessengerscreenbroadcastingwebcamliveicqcameraaimpaltalkmsnstickamyahoosharingdesktopchattingconferencingvirtualanywebcaminstantskypestreamcamfrog
Jukebox Jockey Media Player Pro

Demo by Jukebox Jockey, LLC
17 x 7314Kb downloads

...Party Play Mode At Startup Multi-user Functionality Advanced System Volume Mixer Import Playlists and Metadata Export Reports...
 
touch screen jukeboxjukebox softwarekaraoke softwarevideo jukeboxdigital jukeboxkaraoke machine