1 2 3 4

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Arabesk

Freeware by Remco de Korte
15 x 16Kb downloads

...The arabesk screensaver paints colourful symmetric patterns on your screen. You choose to let...
 
symmetricpatternsabstracrtarabesk

Shareware by Miraplacid
10 x 956Kb downloads

Free Vista Files award
...key algorithm (512/1024/2048 bits key size) - AES symmetric block algorithm (128/192/256 bits key size) - Blowfish...448 bits key size) - Cast5 (Cast 128) symmetric block algorithm (128 bits key size) - TripleDES...block algorithm (192 bits key size) - Twofish symmetric block algorithm (128/192/256 bits key size) - MD5...compatible component, MSCCyrptoPGP. It allows you to exchange symmetrically encrypted information between MSCCrypto and various...
 
linuxvisual basicchiliaspjavascriptsharewareactivexscripting hostcomponentsiisasp componentvbscriptfreewarechilisoftspice
Linear Algebra

Shareware by Orlando Mansur
14 x 2277Kb downloads

...eigenvalues and eigenvectors, establish the definiteness of a symmetric matrix, perform scalar multiplication, transposition, shift, create matrices...
 
matrix algebramathematicsengineeringmatriceslinear algebraequationsscience
...allows you to encrypt and decrypt files using symmetric key and asymmetric key mechanism. It creates a...clicking the archive with the given password for symmetric key mechanism and no input is necessary for...
 
securefilenetmessengerprivateramdecryptionrecruitmentprofessionalscryptographyfreesecuritypkipublicfilesecureencryptionmemoryblowfishself-decryptioncertificateguru
Smart Encryptor

Freeware by Smart Soft
21 x 624Kb downloads

Free Vista Files award
...algorythms existing. AES - the US Government standard symmetric encryption algorythm and Blowfish. Encrypt files and folders...
 
encryption
Matrix ActiveX Component

Demo by Bluebit Software
10 x 467Kb downloads

Free Vista Files award
...Value (SVD) decompositions, Eigenvalue and Eigenvector computation for symmetric and non symmetric matrices. Advanced II edition now...
 
decompositioneigenvaluesmatrixcholeskysvdmatheigenvectors
Amelix FCP

Shareware by Amelix.com
13 x 850Kb downloads

...Amelix FCP allows for the power encryption and decryption of all your personal files. Encrypt and decrypt files of any type. This is symmetric-key cryptography program. Amelix File Cryptor...
 
cryptorcryptography utilitesdecodeprotectcodingprivaciinformationpassworddecodingpaswordamelixcom
FreeSweetGames Kaleidoscope

Freeware by FreeSweetGames
4 x 659Kb downloads

...out on a game field. They form a symmetric pattern. After the beginning of party the pieces...
 
board gamelogic gamepuzzle
QuickCrypt Library

Shareware by SlavaSoft Inc.
13 x 400Kb downloads

Free Vista Files award
...A fast, highly optimized implementation of symmetric (private-key) encryption/decryption algorithms: DES, Triple DES (3DES), DESX,...
 
blockstandardencryptingcryptoapilibrijndael3desencryptionfileencryptedstringcountervisualkeyaesalgorithmblowfishtripledecryptingsymmetriccipherdecryptionmemorydatamodedllprivatebasic
encrypted::Mail

Freeware by Data Fortress
15 x 2072Kb downloads

...users or recipients existing mail client. encrypted::Mail uses symmetric encryption and allows senders to add a pass...
 
encrypted email clientencryption
CommuniCrypt File Encryption Tools

Freeware by CommuniCrypt Software
17 x 1428Kb downloads

...hash of the source file as password for symmetric encryption(64 digits password). Encryption strength AES Rijndael: 256...
 
emailpop3networksmtpencryptionsecurityrsadecryptioncryptocommunicryptcommunication
Pentix

Shareware by AvexLab
16 x 1430Kb downloads

...Five blocks in each figure. You may do symmetric reflection of any figure. You may interchange of...
 
bossfiguresgameblockspuzzlefallingavexlabpentixkey
...and anubis. In this example source codes, the symmetric block cipher chaining mode used is CTR (Counter...
 
tomcryptlibraryfileencryptioncipherswindowssymmetric
Easy Email Encryption Lite

Shareware by Hermetic Systems
6 x 1504Kb downloads

...email program including Outlook Express. It uses a symmetric key method; thus the key used for decryption...
 
secureencryptencryption softwareenciphermentsecurityeasy email encryptionfile encryption
Symmetries

Demo by Nyassa
10 x 3035Kb downloads

...other three draw themselves automatically in a centrally symmetric way. The path they follow will hardly ever...the edge, the square is divided into four symmetric zones. The goal of the game is to...
 
gamefcilestrategiaeducationplaygamesjuegojugareasyeducacinjuegoslgicastrategylogicboardtablerofichas
ShyFile

Shareware by Dr. Bootz GmbH
11 x 4841Kb downloads

Free Vista Files award
...intuitive - no need to study the manual. Symmetric keys are used as opposed to Public and...its own independently developed powerful algorithm, offering a symmetric depth of encryption of up to 6,144-bit, which...
 
html encryptionencodesecure mailsecure chatfile deletionfile encryptionemail encryptioncryptographyfile wipingemail securitydecode
Email Encryption End-to-End

Shareware by Hermetic Systems
13 x 1506Kb downloads

...email program including Outlook Express. It uses a symmetric key method; thus the key used for decryption...
 
encryptionsecuresecurityenciphermentemaileasy email encryptionencryption softwarefile encryption
Infinite One-Time Pad

Shareware by Rolando Santiago
4 x 2039Kb downloads

...Infinite One-Time Pad (IO-TP) is super secure text encryption and decryption software. It is the best solution for encrypting any text documents such as e-mails, instant messages,...
 
hashvernamone-time padsafecryptographyalgorithmencipherinformationmessagesstreamencryptione-mailsymmetricxorotpdecryptiondecipherprotectioncommunicationsciphertext
Free Morphing

Freeware by FilesGuard
40 x 2935Kb downloads

...of frames in sequence. - You can create symmetric sequence. - You can save resulting movies as...
 
freeone face into anotheranimationanimated gifconvertmorphing
Global Tetris

Shareware by AvexLab
25 x 1424Kb downloads

...game. Features: Five games in one. You may symmetric reflect any figure. You may interchange of current...
 
consistesavexavexlabtetrisblocksfallingglobalgamespuzzle