Sort by : ReleasedNameDownloadsAddedRatingRelevance
Back4Win

Freeware by AGM
48 x 913Kb downloads

...doing your backups, and much more. Extensive Device Support - CDRW, DVDRW, Internal/External/Networked Hard Drives, MO, Zip...
 
backup softwarebackup utilitywindow backupcomputer backupzipdata backup
Host Evaluator

Freeware by Zed Seven Pty Ltd
12 x 383Kb downloads

...of server downtime, slow connections, and/or poor tech support and customer service. Finally there is a way...and make the move. With the Host Evaluator software you can add the web hosting plans you...host, you can still use the Host Evaluator software to continue to check your new server`s uptime...time! And the best thing is that the software is totally free!...
 
uptimeserveralertshostingwebsitemonitoringpingcompare
Easy Email Sender

Freeware by TEC Software
52 x 6700Kb downloads

...Powerful bulk email software program with easy to use wizard style interface....
 
serversoftwareemailbulkadvertisingmarketing
Vista NetMail

Freeware by SoftwArea.com
35 x 1700Kb downloads

...free, fast and flexible email client. The program supports multiple email accounts, lets you automatic sorting of...subject, colour, in ascending or descending order The software will be useful for both electronic business professionals...Options are also provided for standard e-mail clients: support of attachments, addressbook, multipart html messages, message searches...
 
mailingemail softwareemail clientlistmerge
Nidesoft DVD Ripper

Shareware by Nidesoft Inc.
98 x 5263Kb downloads

Free Vista Files award
...3GP, 3GPP, ASF, VOB, H.264, M4V, etc. 3. Support video Trimming and Cropping, set the start and...AVI Converter for free and enjoy it. The software will be free updated for ever. Some related...
 
dvd converterdvd ripperdvd ipoddvd mp4dvd pspdvd avidvd rippingdvd 3gpdvd zune
Web CEO Professional Suite

Shareware by Web CEO
31 x 30152Kb downloads

...Web CEO is a powerful professional software suite for site owners, webmasters, e-marketers and web...your customers. With Web CEO you receive high-quality support which includes video tutorials, quick start guide, support...center. If that`s not enough, the customer support team is ready to answer any questions....
 
search engine submissionftp upload managerweb analytics toolkitwebsite auditseokeyword researchhtml editorlink buildingsearch engine optimizationlink exchangeweb promotionkeyword ranking checkersite uptime monitoring tool
netChimes

Freeware by Birnam Labs
18 x 1857Kb downloads

...downloads. Shareware authors can receive alerts when their software is being downloaded. Email marketers can plant images...unlimited alert configurations, and the server scripts can support multiple client connections, so you can share your...
 
statisticsnetchimescountmessengeralertvisitorwebmasterweblog
FlexWizard - Site management via e-mail

Freeware by FlexWindow
16 x 569Kb downloads

...by anyone, solely using any e-mail client. - Support for MS Word e-mail, HTML e-mail and plain...text e-mail. - Support for adding or replacing content. - Advanced features,...
 
flexwindowupdatesyndicationserviceemailwebsitemanagementdemonstrationbasice-maileasyintegrateon-lineprofessionalonlinebusinesscontentcmsfreesimple
PythonGuide

Freeware by InnerPeace.Org
12 x 270Kb downloads

Free Vista Files award
...easier than learning Perl. PythonGuide is Forever Free Software licensed under the GNU General Public License of...the Free Foftware Foundation. Thank you for your support of InnerPeace. InnerPeace is not primarily a webmaster...
 
4hexillionhtmlcomboinnerpeacejavascriptgraphicspickercolorstoolkitwebmaster

Freeware by IRCXpro
10 x 6662Kb downloads

...IRCXpro Messenger supports all common IRC client functionality from full color...Panel for quick and convenient access. The client software is designed to run from the System Tray....Windows Domain integration using NTLM and SSL Encryption support (for both Client to Server and User to...from the dangers of Internet chatting and Unicode support allowing multilingual communications....
 
chattalkircdconferenceircxmirc
Free Vista Files award
...Free TurboNote sticky note software is a handy PIM organizer and instant messaging...which appear in notes, simply by double-clicking. Network support suits organisation-wide deployment and TurboNote can be run...
 
sticky notesfreewarescheduleremindermessagingorganizeraffiliate programturbonoteinstant messagebusiness productivity toolpimalarmdesktop note
...program that aids developers in submitting their trial software to software download sites. The program includes a...allow site submission from within the program itself. Software authors can easily visit a software site`s home,...After visting the submit page, authors submit their software to a site by pasting these items into...password and login ID for each site. The software contains a site update feature and has the...
 
trialuploadsharewaretrialwareauthorsoftwaresubmission
...This major update contains network play fixes, joystick support, and all keys made re-definable. The War Games Construction Kit is a 3D interactive arcade game, play single player or...
 
excession softwarewar games incfirst personexcession enginelandscapethird personarcade
EScrambler - Webmaster Antispam Utility

Freeware by InnerPeace.Org
17 x 9Kb downloads

...jpeg of an envelope. Escrambler is Forever Free Software licensed under the GNU General Public License of...the Free Foftware Foundation. Thank you for your support of InnerPeace. InnerPeace is not primarily a webmaster...
 
anti spamtoolkitscramblerwebmasterinnerpeaceemailaddressfighterjavascriptescramblerhtmlblocker
Fresh Download

Freeware by Freshdevices.com
102 x 2101Kb downloads

...is an easy-to-use and very fast download manager software that turbo charges downloading files from the Internet,...collections, etc. Unlike any other similar utilities, this software is 100 percents free, no charges, no banners...in the software (which steal your bandwidth), no spyware. Key features...for the same file, while many other similar software only support single connection download. Based on user...both HTTP and FTP protocols.
 
download optimizerdownload managerdownload acceleratormp3internet optimizermusicspywareinternet boostmpgadszip
EaseUS Partition Master Free Edition

Freeware by Yiwo Tech Ltd
87 x 25771Kb downloads

...EXT2/EXT3 partition to avoid any personal, hardware or software failure, virus attack, or hacker`s intrusive destruction partition...space. Disk surface test. Set Active/Label, hide/unhide partition. Support MBR & GPT disk (2TB partition on MBR...size on GPT), removable device and hardware RAID. Support up to 32 disks....
 
copy dynamic diskpartition managereaseusdisk and partition copyeaseus partition mastermove partitionresize partitionfree partition managerpartition magicmerge partitionconvert partitionresize dynamic system volumeresize raid
iSharesoft PS3 Video Converter

Shareware by iSharesoft.com
4 x 16123Kb downloads

...iSharesoft PS3 Video Converter is easy-handled conversion software which implements your ideas of converting MP4 to...perfectly with personalized parameters setting. In addition, it supports the output files as definition 480p/720p and 1080p....3. Add function of volume control. 4. It supports definition 480p, 720p and 1080p/ MPEG4 AVC. 5....It supports H.264/MPEG-4/AVC Video Format and MP3/AAC Audio Format. 6....
 
ps3 converterps3 video convertersony ps3
Database Manager

Freeware by Inner-Smile.com
27 x 816Kb downloads

...This tool will support you in your database management activities for dBase-compatible...or the Advantage TDataSet descendant or MySQL tables. Supported functions are: Table creation (generates table creation source...encryption, packing tables (permanent removes "deleted" (hidden) records), supports deletion, adding, editing and converting database records, displays...order, undeletion of individual or groups of records, supports Clipper-, FoxPro-, and HiPer-SIx...
 
hipersixclippertableconvertapollocdximportdatabasesntxdbfdecryptmysqladthiper-sixadvantagedatabasemaintainindexfoxprofreewareencryptmsqldelphipackfoxbaseproxmldbaseexport

Freeware by Miha Psenica
20 x 142Kb downloads

...clipboard, search for strings and print. The program supports drag & drop. Multilanguage support for English, Slovene,...
 
sharewaretxtjavabrkljalnikfreewarezastonjsourcecodeviewsoftwaretextpsenicaoperamihabrowsergledalec
LabVault Data encryption utility

Freeware by Labtam Inc.
9 x 1163Kb downloads

...LabVault is a software package that any user with a PC running...
 
security softwarecomputer securitydata encryptiondata protectionfile encryptionfile protectidata securityfile lock