1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21

Sort by : ReleasedNameDownloadsAddedRatingRelevance
VoIPerized

Freeware by Jeroen de Kleijn
155 x 316Kb downloads

...people at the same time - Contact list supports unlimited number of contacts - Adjust the bitrate...
 
upnplow latencyspeexinternetcommunicationsvoiperizedconferencevadhigh qualitytelephonyvoice overchattelephonefreewareaudio
...receiving, buffer congestion and flow control. There is support for automatic DNS name resolution and SOCKS proxy...
 
securenetworkingencryptionprivate
VZOchat

Freeware by Visicron Systems, Inc.
123 x 2840Kb downloads

...require special skills to use. Its advanced network support allows connections when both users are behind a...software provides good video quality with full-screen video support and a noise-reduction feature for noisy USB cameras....detailed user information with a photo. The software supports downloadable skins and language packs....
 
video chatvideo messagingvideochatvideo communicationvideo conference
SkyFex Remote Desktop

Freeware by Tomsk, Inc.
88 x 2016Kb downloads

Free Vista Files award
...it. SkyFex is a secure service for remote support solutions and help desks. It works directly in...Remote computer control via mouse and keyboard; - Support of Firefox, Chrome and Internet Explorer (including IE...
 
remote destopdesktop streamingremote accesshelp desk softwareremote assistancedesktop sharingremote supportonline collaborationremote desktop controlremote solutionremote support softwareremote control
Stamina Typing Tutor

Freeware by TypingSoft
61 x 1367Kb downloads

...Amusing, yet multifunctional touch-typing tutor with support for several layouts: QWERTY (US, UK, ...), Dvorak,...type away long emails (spam), efficiently misbehave in chat rooms, ICQ and so on without ever looking...hidden), super MP3 sounds and music, a playlist, support for several users, user-friendly thought out interface, detailed...
 
teachdrillsprogramlearningspeedtestlessonsnovicekeyboardingtutorfingersgameeducationaltouch-typingtrainer
TipicIM

Freeware by Tipic, Inc.
76 x 4324Kb downloads

...and safe. Some of TipicIM features: - Audio/Video Chat - Wideband high quality audio - Chat or...- Multiple profiles - Auto-reconnect - SOCKS proxy support - Secure encryption (SSL)....
 
instant messagingtipicimjabber xmppvoipwebcamvoice callskype
SysAid IT Management Software

Freeware by SysAid Technologies
73 x 383336Kb downloads

...history) and raising early warning alerts (email, SMS). Support your users anywhere around the world, via SysAid...
 
cmdbbenchmarkhelp deskslapatch managementmonitoringknowledgebaseself servicechatreset passwordmdmslmmobile device managementbyoditilremote accessasset managementremote control
IceChat IRC Client

Freeware by IceChat Networks
58 x 2730Kb downloads

Free Vista Files award
...connect to many IRC Servers, has full scripting support and customizable popup menus, and a unique, easy...with a very easy to use Server Tree. IceChat is in constant development, and is aimed at...
 
chatclientirc
Boldchat

Freeware by BoldChat
31 x 8100Kb downloads

...Free live chat software for online sales and support teams. Increase sales, improve customer service, and reduce...costs. Simply install the client and add a chat button to your website to start chatting with...click-to-call visitors to click-to-call and and initiate pro-active chats with visitors. Used by over 11,000 active websites....
 
contactscrmticketlive supportlive chathelp desksoftwareweb logcustomershelpdeskcontact managerweb statssalesemail managementwebmasterweb logsemail managerweb statisticsweb analyticslive help

Freeware by IRCXpro
53 x 6662Kb downloads

...IRCXpro Messenger supports all common IRC client functionality from full color...message, the system tray icon flashes with a chat bubble and a double click will quickly open...Windows Domain integration using NTLM and SSL Encryption support (for both Client to Server and User to...protect young users from the dangers of Internet chatting and Unicode support allowing multilingual communications....
 
chattalkircdconferenceircxmirc
Profi

Freeware by Information Systems
33 x 757Kb downloads

...Project PROFI v 2.1 was developed for use in personnel agencies or personnel department of small and middle sized enterprises. Basic configuration of the project includes: information about customers...
 
convert excelvacanciesresume on-lineadditional modules requestprogram for personal agenciesstatisticsopen soursefreepersonnel agency databasevacant seats
x Chat Free

Freeware by xStudio.ca
86 x 3630Kb downloads

...x Chat Free is a private one-on-one real time intranet...blocking enhance the security issues of your private chat session. Combined with text to speech (TTS), network...screen capture, auto-connect/notify, instant shortcut messages, alert ring, chat saving/reader, drag and drop support, URL history, chat...request auto popup, and many customized features, x Chat Free is most flexibility, functionality, customizable and user-friendly...
 
tts chatnetwork chattext chatnetwork utilities
Boldcenter Operator Client .NET

Freeware by Bravestorm, LLC
18 x 4263Kb downloads

...Free live chat software for online sales and support teams. Increase sales, improve customer service, and reduce...costs. Simply install the client and add a chat button to your website to start chatting with...emails, manage help desk tickets, and initiate pro-active chats with visitors. Used by over 11,000 active websites....
 
crmsoftwareweb statscontact managerlive chathelpdeskhit counterweb logstickethelp deskemail managercustomersemail managementwebmasterweb statisticslive supportsaleslive helpcontacts
Likno eLearning LMS

Commercial by Likno Software
12 x 339Kb downloads

...lessons at multiple conceptual levels called categories. - Support for forum, chat, calendar, personal messages, etc. -...Content Editors with support for pictures, sound, video, flash or java -...& share files - Test Builders - SCORM Support - Projects: Assign projects with deadlines - Multilingual:...Unicode support (full language administration module). - Surveys: Create, share...
 
learning platformlmscourse management systemsoftware elearningweb based trainingscormlearning management systemscoursewarelearning management softwaresoftware e-learning
UltraVNC

Open source by UltraVNC Team
131 x 3300Kb downloads

Free Vista Files award
...a simple Web Browser on any Operating system supporting Java™ (Linux, Mac OS...) to an UltraVNC server....
 
freeware
IMTiger

Freeware by IMtiger Software Ltd.
62 x 2039Kb downloads

...and you can talk with them. IMTiger features: support unlimited number of MSN/AIM/ICQ account in one MSN...buddy`s present status in MSN Messenger`s contact list. Chat with AIM/ICQ buddy in MSN Messenger....
 
chat onlineimtiger messengermsn addonsdesktop toolsaimyahooinstant messengermulti messengericq
iGo Incognito

Freeware by Incognito Systems
71 x 1541Kb downloads

Free Vista Files award
...available. iGo Incognito provides encrypted instant messaging, private chats and open forums. The iGo Incognito network is...(or ever can) reading or intercepting your messages, chats and files, iGo Incognito is for you. As...messages and files, and you can engage in chats and open discussion forums. However with iGo Incognito...online to receive the message - iGo Incognito supports offline messaging. iGo Incongito also support voice messages...
 
folderdiscussionfileencryptionprivacychataesvoice messageinstantsecuritypublic keyforum
LanToucher Network Chat

Freeware by Vital Sound Laboratory
119 x 1668Kb downloads

Free Vista Files award
...LanToucher Network Chat is small and easy-to-use chat software for your small office or home LAN...(Local Area Network). This easy-to-use LAN chat program with simple, intuitive user interface and a...for your small office LAN and a perfect chat application for your private home network or intranet....LanToucherâ„¢ Network Chat software supports the system tray (taskbar notification area) and sound...
 
instant chatintranet chatnetwork chateimchat messengermessenger servicelan chatnet sendwinpopup
Free Vista Files award
...during a Skype call) - Answering machine - Chat auto reply when you are away - Application...
 
productswebsitecommunitymachinesystemsupportanswering machinemessagesmailautomaticchatvoicemailupgradescontactvoipdesignskypemessagingpamelafeaturestextsoftware
MorphVOX Junior

Freeware by Screaming Bee LLC
96 x 1864Kb downloads

Free Vista Files award
...will change the way you play games or chat online. Change your voice to sound like man,...works with all the popular game and online chat programs including Skype, AIM, Yahoo, MSN, GoogleTalk, TeamSpeak,...your voice Integrates easily with online games and chat programs Low bandwidth and CPU usage Built-in Voices...Built-in sound effects Full key, mouse and joystick support for gamers...
 
changingtalkskypevoipgamesfreesoftwaremessengervoice changeronlinechatteamspeak