1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance

Shareware by ECTACO, Inc.
19 x 2760Kb downloads

...Talking Partner Dictionary for Windows provides bidirectional word translation and synthesis of speech. The dictionary is easy to install on a desktop computer. One of its remarkable features is voice...
 
ttstranslatevoicedictionaryectacotalkspeech
Learn To Speak French

Shareware by Aaresoft inc
33 x 5020Kb downloads

...Learn To Speak French is specially developed for people who are learning...in a small screen format so you can study while doing other work at your computer! This...second of your time useful! Learn To Speak French comes with a conversation kit, vocabulary builder, dictionary,...and ease of use make Learn To Speak French stand out among the likes. No matter what...your French level is, you will find that Learn To...
 
learn speak frenchlearn french
Free Vista Files award
...and fun. Teachers and students can create new study modules with the easy-to-use built-in editor. Quiz-Buddy interface...notes can be added to each question-answer pair. Study modules can be saved in Palm OS format...Unlimited number of quizzes - Over 110 sample study modules (SAT, Spanish, French, Italian, Portuguese, Geography, Math,...
 
state capitalsdrillspanishmemoryflashcardsmemorizequiz-buddypalmlearndictionaryhistorical datespsatmoney-back guaranteevocabularylanguageforeignfrenchmultiple-choicetest preparation
LingvoSoft FlashCards English <-> German for Windows

Shareware by ECTACO, Inc.
29 x 1710Kb downloads

...be consulted in English, Russian, German, Spanish, or French language. It also includes a feature that lets...
 
dictionarytranslategermanenglishectacolingvosoftstudyflashcards
LearnWords Windows

Shareware by LearnWords Software
26 x 6195Kb downloads

Free Vista Files award
...- games and amazing forms of levels of study - creation and editing of dictionaries built-in "Editor...incorrect answer) - information panel of process of study for each word (number of a levels, name...for yourself: - different exercises makes process of study in game and amazing forms; - the sequence...
 
wordphraselanguagelearnpronunciationwordseasygrammarstudyexercisetranscriptionfast
...automoving of words is the method of passive study like the slide-show with words - transcription and...- games and amazing forms of levels of study - creation and editing of dictionaries built-in "Editor...incorrect answer) - information panel of process of study for each word (number of a levels, name...
 
easylearngrammarwordslanguageexercisephrasepocketpronunciationfasttranscriptionstudy
Recite French Words

Shareware by ReciteWords inc
22 x 4898Kb downloads

...learning can be hard work. You need to study hard and practice a lot! However, the right...tools, such as our new Recite French words, it can make learning French easier and...Our software will help you learn French. Recite French words is specially developed for people who are...increase French vocabulary. It provide 44 categories including 2924 classical...you can make settings by yourself for your study aims.
 
learn wordslearn pronunciationfree online educationcomputer assisted learningvocabulary builderlearn vocabularyvocabbuilderlotetutorfrench vocabularyincrease your vocabulary
...singing skill is hard work that demands intensive study and practice. However, the right tools can make...
 
japaneseforeign languageeflspeakgermanfrenchenglishvocal coachstudysingingkoreaflteslspeakinglisteningchinesespannish
ECTACO Voice Translator English -> Chinese

Shareware by ECTACO, Inc.
36 x 9368Kb downloads

...a dictionary, especially if you just started to study the language. System requirements: Processor: Intel ARM-206 SA1110...
 
bookrecognitiontranslationvoicettsspeechectacodictionaryspeakphrase
Pop-Up Dictionary

Shareware by Ice-LC Software
26 x 4827Kb downloads

...This program will help you translate texts from virtually any language. Just select an unknown word in your text, press Ctrl+Ins+Ins and you will see the translation, press...
 
translateportuguesehungariangreekenglishfrenchforeignswedishrussianturkishdanishgermanstudypop-upbalticvocabularyice-lc softwaredutchlanguagedictionarycrammerwordspanishitaliansearchhebrewarabicheartlearn
WDumpEvt

Shareware by Isabelle Vollant
20 x 395Kb downloads

...in ASCII-delimited, CSV or html format. You can study the log from any remote computer by browsing...
 
system administrationsharewareprintwindows 2000 securityreporting tooleventlog monitoringauditrasdumpwindows securityapplicationuserservice
ActivityMaker

Shareware by Gepeto Software
24 x 3100Kb downloads

...worksheets, "secret code" worksheets, riddle activities, alphabetize worksheets, study guides, definition fill-in sheets, and more. A wide...
 
itallianfrenchgermanteaching toolsspanishsciencelanguage artsworksheetssocial studieshome schoolpuzzlesforeign languageenglishword searchcrosswordsportuguesevocabulary
StudyX

Shareware by PlazSoft
30 x 8357Kb downloads

...This flash card maker is amazing! StudyX has 60 languages built in and is designed...answer format. Once material is entered, the versatile study options include study games, on-screen or paper flash...cards, autopilot studying, study sheets, and multiple choice, fill-in-the-blank and matching tests....An intelligent engine tracks students’ progress while they study on screen using digital flash cards, study games...
 
flashcardsmathstudyxsciencestudy chinesekoreannotecardsstudy softwarespellingreadingstudy gamesflash cardstudy spanishenglishrussianjapaneselatinhistoryforeign languagesflash card makervocabularyfrench
Aurinko - French Language

Shareware by LTI Ltd.
28 x 17733Kb downloads

...by category (vocabulary, phrases, etc.) to maximize their study time. Self-test options include user-selected time limits for...
 
learn speak frenchfrench learningself studymp3conversationlearn french
LearnWords WM5

Shareware by LearnWords Software
34 x 1011Kb downloads

Free Vista Files award
...- games and amazing forms of levels of study - creation and editing of dictionaries built-in "Editor...incorrect answer) - information panel of process of study for each word (number of a levels, name...
 
exercisetranscriptionstudypronunciationlanguagewordstrainingphraselearngrammar
Han Trainer Screensaver

Freeware by Rainer Stahlmann
40 x 8118Kb downloads

...Screensaver that teaches the 100 most common Chinese characters through understanding. Shows stroke order animation and English/German/French/Spanish translation of Chinese characters. Additional sound output (...
 
learnstudychinesemandarinfreelanguagescreensaverstroke orderasiahsk
Easy French Dialogs

Shareware by Mskpl inc
30 x 4885Kb downloads

...Easy French Dialogs is a very practical study tool for learning French, it gathers 678 pcs...so on. The software presents the content of French dialogs and English dialogs showing on screen by...of playing small slides, as well as reading French aloud to let you study French dialogs at...tool which you can use to read the French compositions compounded by you from different places. A...
 
study frenchlearn speak frencheasy french dialogs
Aurinko - Learn French (OEM)

Shareware by LTI Ltd.
20 x 17733Kb downloads

...by category (vocabulary, phrases, etc.) to maximize their study time. Self-test options include user-selected time limits for...
 
learn speak frenchself studyfrench learningmp3learn frenchconversation
StudyBook French

Shareware by Lexis Rex
26 x 2759Kb downloads

...The Lexis Rex StudyBook - French combines an eBook with audio and study tools...where you can store your focus words for study and rote learning. Promote these to your list...
 
learningaudioflash cardssentencemp3frenchlanguage
memoWORDS Learn French

Freeware by alanges.com
28 x 1247Kb downloads

...memoWORDS allows you to learn French words easily. It doesn`t work like a boring...to memorize words faster and easier. It makes studying more pleasant. It is user friendly with 3D...
 
pdastudy frenchflashcardslearn french wordspalmtopflash cardsvocabularycell phone