1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
HashCalc

Freeware by SlavaSoft Inc.
50 x 468Kb downloads

Free Vista Files award
...It supports 3 input data formats: file, text string and hexadecimal string. It is a very fast,...
 
checkerfilealgorithmveriifyingtesterchecksumcheckingpasswordkeymessageencryption128hashhmacverifiercalculationdigestgeneratorcrcdataverifycalculatetestingauthenticationbitcomparecomparationcomparing
1Crypt

Shareware by Atma Software
21 x 839Kb downloads

...A quick and professional way to add strong encryption to your application. 1Crypt is an ActiveX control...you to easily and securely encrypt files and strings using 256-bit AES Rijndael) encryption. String and file...ceccksums using SHA 256-bit hashes. Using strong encryption in your application doesn`t have to be complicated....
 
encryptionapplicationstrongfilesrijndaeldll256-bitprogramaddaeslibrarystringsfunctions
Delphi ZIP Component ZipForge

Shareware by ComponentAce LTD
18 x 14354Kb downloads

Free Vista Files award
...archives support, repair, encryption, unicode filenames support, Zip64, string AES encryption splitting and multi-spanning support. Full source...and multiple disk spanning support - Strong AES encryption with 128, 192 and 256 bit keys, compatible...
 
zip componentdelphi zip componentzip delphi
AidAim MsgCommunicator

Shareware by AidAim Software LLC
17 x 3871Kb downloads

...instant messaging (IM) applications with data compression, strong encryption and advanced networking technologies. MsgCommunicator supports both client/server...allows sending and receiving binary buffers, streams, and string messages to any network client even it is...ratio with data of any type. MsgCommunicator supports encryption of the network traffic using any of 12...
 
vcl componentdelphiinternet communicationstoolscomponentsstrong encryptioninstant messaging sdkclientserverdata compressioncbuildericqkylixinstant messengeraimconnectionpeer-to-peerutility
QuickHash Library

Shareware by SlavaSoft Inc.
17 x 692Kb downloads

...A fast, highly optimized implementation of hash and checksum algorithms: MD2, MD4, MD5, SHA-1, SHA-2(256,384,512), RIPEMD(128,160,256,320), PANAMA, TIGER, CRC-32, CRC-...
 
authenticationbasicdigest128libencryptionalgorithmmessagebitvisualhashcrc16dllmemorycomponentsha2digitalpasswordstringsignaturehmacchecksumkeyfilesha1blockcrc32checkingtlbdata
QuickCrypt Library

Shareware by SlavaSoft Inc.
20 x 400Kb downloads

Free Vista Files award
...DES (3DES), DESX, BLOWFISH, RIJNDAEL (AES - Advanced Encryption Standard), GOST (USSR/Russian Encryption Standard). It supports 5...
 
blockstandardencryptingcryptoapilibrijndael3desencryptionfileencryptedstringcountervisualkeyaesalgorithmblowfishtripledecryptingsymmetriccipherdecryptionmemorydatamodedllprivatebasic
CryptIt

Shareware by ACAPsoft
31 x 42Kb downloads

Free Vista Files award
...physics!) CryptIt is designed to use conventional XOR encryption on keys that are the same size as...
 
encryptxorvernamsecurityfileassemblyone-time padsinner
PDF-Writer.NET

Shareware by dbAutoTrack Ltd.
62 x 4067Kb downloads

...to reduce size of PDF file. ->Built in encryption (40 & 128 Bit) and hash algorithm. ->Digitially...
 
pdf netpdf source codenet pdf componentpdf component aspnetnet pdf librarypdf library aspnetpdf aspnet
...Cryptocx is an encryption OpenPGP (PGP) component dll designed for use in...important, with developers wanting to add secure data encryption facilities to their programs and web sites. The...versatility of Cryptocx, combined with the fastest file encryption available anywhere, full PGP support and the ability...and secure. Cryptocx is the only Enterprise Ready Encryption component. Cryptocx is in use by many of...
 
openpgpsdacomponentdllmd5aspaesblowfishencryptdecrypt
.NET Obfuscator Dotfuscator

Commercial by PreEmptive Solutions
40 x 32382Kb downloads

...best of decompilers from producing useful output. * String Encryption * Several predefined renaming schemes including unprintable characters...
 
watermarkercode protectionnet obfuscatorcompactor
Java Obfuscator DashO

Demo by PreEmptive Solutions
31 x 16666Kb downloads

...patented Overload-Induction(tm) * Advanced Control Flow Obfuscation * String Encryption Java Code Efficiency * Unused Class/Method/Field and constant...
 
code protectionwatermarkerjava obfuscatorcompactor
LitePDF ActiveX Control

Shareware by Polestar Software
19 x 1128Kb downloads

...and line spacing. 11. Support adding path from string like SVG. 12. Support geometrical shapes like lines,...
 
delphivisualfoxpropythonjscriptactivexvbscriptocxpdf generatraspnetjavapostscriptphpgeneratorperlcomponentpowerbuildermake pdfpdf creator
Free Vista Files award
...ActiveX component for ASP or ASP.Net ***Support standard encryption and decryption algorithm like RSA, RC4, DES etc...RC4, DES, 3DES, 3DES2, AES128, AES192, AES256. The encryption and decryption algorithm is implemented by underline crypto...easily calculate the hash value of a file, string or a binary buffer. The value can be...create digital signature to futher improve security. Support encryption and decryption of file Support encryption and decryption.
 
asphashdecryptionencryptionaspnetactivex component
...The CryptoText encryption library contains COM and .NET components for cross-platform...Microsoft Windows text and file encryption on Pocket PC and Desktop, including components for...using RC4 or 3DES, transfer the encrypted BinHex string up to a webserver and decrypt in ASP...
 
passwordcomponentencryptioncryptoapipocketpcprotectiondotnetevbevc
...TN BRIDGE 3 is the new web-to-host terminal emulator for IBM Mainframes and AS/400, designed to take full advantage of the web technology. It works as both...
 
400web-to-hostemulatortn5250tn3270mainframeterminaltelnet390midrange
Workshare Protect Premium

Commercial by Workshare, Inc.
23 x 128974Kb downloads

...through fully administered settings. Concerns such as a string of digits similar to a social security number...content, conversion of any file into PDF, and encryption for added security. You can fully administer your...
 
whole diskcleanezcleanhidden datasecureprotectmetafindfull disk encryptiondeltaviewcontentiscrubdata securitymetadatapdfleakdocument securityworkshare
...related with security purpose such as password protection, encryption level, page restriction, high resolution as well as...document assembling. * You can work with two encryption levels like 128bit and 40bit. * You can...
 
securityuserremoverunlockfileannotationpasswordrestrictionsoftwarepdfdecryptownerprintdocumentbreakprotectencryptmodifyadobeun-restrictcontentunprotectcopyeditacrobat
TekRADIUS

Freeware by Yasin KAPLAN
38 x 1500Kb downloads

...- Deriving Keys for use with Microsoft Point-to-Point Encryption (MPPE). You can authenticate and authorize PPTP/L2TP connections...
 
radius server for windowseap-md5rfc 2865sqlchap2966pap
Flash Secure Optimizer

Demo by Eramsoft
18 x 1634Kb downloads

...Flash CS5 and ActionScript 3. Identifier Renaming(Identifier Obfuscation), Strings Encryption, Encrypted Domain Locking, Obscuring ActionScripts. FSO lets...
 
adobeprotectobfuscatoridentifierobscuringstring encryptionoptimumcompressobscureactionflashcompactiondomain lockingactionscriptsprotectorcompressionsecureswfobfuscationoptimaloptimizer
PD4ML. HTML to PDF converter for Java

Shareware by zefer|org
23 x 1407Kb downloads

...Main features: - Convert an URL or HTML string to a PDF file or byte stream. -...selected pages - Embed attachments - Switch PDF encryption on and assign document security restrictions - Generate...
 
transformpdf htmlpdf strutshtml2pdfsource codepdf jspconverterjava html pdfpdf classpdf generatorpdf serverpdf javapdf templatedynamic pdfpdf csssoftwarepd4mljar pdfgenerate