Sort by : ReleasedNameDownloadsAddedRatingRelevance
Sea Battle

Freeware by KARPOLAN
378 x 550Kb downloads

...find the game very playable and forget about standard windows games at all :) Absolutely free. Sea...
 
boardkarpolanseashipbattlegame
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
453 x 1719Kb downloads

Free Vista Files award
...XP/Vista to a potentially large audience, using a standard web server as a bandwidth amplifier. All you...
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Access all groupware functionality from anywhere using a standard web browser.The Outlook Connector provides real-time, two-way synchronization...between Outlook (2002/2003/2007) and the Groupware server. Any standard POP3 and IMAP4 client can be used to...also supports LDAP over SSL (LDAPS). Support for standard public key encryption and signing of e-mail encapsulated...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
Photo Gadget Viewer

Freeware by XemiComputers Ltd.
364 x 864Kb downloads

Free Vista Files award
...fast in opening a photo file and offers standard keyboard shortcuts to look at other photos available...
 
view thumbsview picturesshow thumbsphoto gadget viewerbrowse imagesview photosshow photosshow thumbnailsshow imagesview imagesdisplay photosview thumbnailsshow picturesxemicomputersdisplay pictures
Paessler URL Recorder

Freeware by Paessler AG
92 x 740Kb downloads

...a sequence of URLs. It works like a standard web browser, whereby you enter a URL at...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Mach5 Mailer

Freeware by Mach5 Development
114 x 9854Kb downloads

Free Vista Files award
...Take the bulk out of email! Simple, Free, and Effective. Send personalized email messages to customers, from any database source including Access and Excel, with conditional content, HTML formatting, and...
 
sqle-mailphpmergeattachmentsinfactajavascriptmicrosoftcsvbulkvisualwindowsnewslettermailingsodbcopt-inlisthtmlnotificationworldmailvistaexcelsoftwaremassemailerdatabasecustomizemarketingaccess
m9P Zipper

Freeware by mental9Production
160 x 2037Kb downloads

...Also, m9P Zipper zipped-files are compatible with other standard zipping programs, and vice-versa, m9P Zipper can unzip...
 
unzipdecompress
AdvancEd NC Editor

Demo by NC systems laboratory
140 x 5837Kb downloads

...flow programs. AdvancEd provides all functions of the standard text editor and, besides, a number of additional...
 
iso-7bitg-code editorpart programm editor
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
137 x 26624Kb downloads

...MIB Node Viewer and MIB Module Viewer). The Standard Edition has 27 tools, which includes Network monitoring...
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools
PicaJet Photo Organizer

Freeware by PicaJet.com
161 x 5064Kb downloads

Free Vista Files award
...each photo for organizing your collection. Use Picajet`s standard icon set or generate the icon from the...
 
photo organizerphoto organizingphoto gallery softwarephoto management softwarephoto album softwarecataloging tool
CogeXP

Freeware by Info Lab srl
108 x 25309Kb downloads

...Tra le principali caratteristiche ricordiamo: Piano dei conti standard su tre livelli (secondo la IV Dir. CEE)...
 
prima notacontabilit ivagestionale freesoftware contabilitaprogramma contabilitsoftware contabilit gratuitocogespesometro 2013
DXF Import/Export Converter

Freeware by S&G Team
155 x 10223Kb downloads

...vector-based files. AutoCAD DXF is an open industry standard for the exchange of CAD drawings. DXF Converter...
 
importautocaddxfconverterexport
EfreeBuy Folder Icon

Freeware by EFREEBUY
241 x 686Kb downloads

....exe files.Aren`t you bored with the way the standard Windows folders look?Make your folders different, make them...
 
folder iconfolercustomize icon
EControl Syntax Editor

Freeware by EControl Ltd.
92 x 952Kb downloads

...for any type of text file. Lexer uses standard VCL resource streaming and stores itself in DFM...
 
aspspell checkingeditfoldinganalysishighlightingsyntaxhtmlxmlformateditorcontrolplain textkeymappingcode editorphplexer
IconoMaker

Shareware by Icon Empire
176 x 5954Kb downloads

...graphics formats. Create and edit icons in either standard or custom sizes, with color depths up to...
 
designmakericonos32-bitwindows
PhraseExpress Text Expander

Freeware by Bartels Media GmbH
134 x 3803Kb downloads

Free Vista Files award
...query of a highlighted text on-the-fly. The PhraseExpress Standard Stand-Alone Edition is free-of-charge for personal users (more...
 
abbreviationabbreviationsautotextsphrasessignaturessnippettypingautocompleteshortcutshortcutsclipboardsnippetspredictivehotkeyautocorrecthotkeys
...19 objective metrics and 5 plugins. Among them standard metrics ( PSNR, MSAD, SSIM, VQM, etc )...
 
videogpussimquality measurepsnrms-ssim
Event Log Explorer

Shareware by FSPro Labs
43 x 4792Kb downloads

...a vital task for any system administrator. The standard Windows Event Log Viewer has limited facilities, and...Application and other Microsoft Windows logs. It extends standard Event Viewer functionality and brings a lot of...
 
monitoringsystemeventsviewinganalyzerwindows event logbackupviewersecurityprintexportapplication
...of RIFF INFO tags ensures backward compatibility with standard Windows players like MS Media Player. abcAVI Tag...
 
copyrightfourcc changercatalogtitlesearchdecoderauthoringmeta tagsvideo and audiocodecencodertags editordivx
...inherited from ImageButton, will behave exactly like a standard image button with extra byte[] type property named...
 
blobupload controldownload controlsqliframe controlblob controlserver controlashx handleraspnetfile controlimage control