1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Vault :: Multiple File Upload and Download Applet

Shareware by Scand
28 x 157Kb downloads

...and high-performance file transfer that works over http, SSL (https) with or without proxy. Moreover, you can...
 
unlimitedjavaappletupload managercancelvaultprogress barfile uploadhttpsscandproxymultiple filelarge fileuploaderserverssl
Free Vista Files award
...MailBee IMAP4 ActiveX component enables Windows and classic ASP applications to search, receive, parse, upload and manage mail and folders on IMAP servers (including Gmail). Supports TLS/SSL, S/MIME,...
 
objectappenduploadmimentlmreceiveaspfoldergmailvb6idleretrieveemailhtmlquotadlle-mailvbaattachmentsslenvelopeactivexcomponentsearchgssapiparseimapimap4delphivisual basicdeleteheadermessage
Free Vista Files award
...MailBee.NET POP3 component enables .NET applications to receive, parse and manage mail on POP3 servers (including MS Exchange and SSL-only servers like Gmail). Written in 100% managed C#...
 
mailauthenticationmimeheaderntlmhtmlemailssljunkdllaspsmimereceivedotnetgssapideletemessagemobilee-mailserverspampopaspnetcompactcomponentproxypop3streamvbnetgmailattachmentretrieve
BugMail

Shareware by Primusat
7 x 181Kb downloads

...any size to your email, send it with SSL encryption and more than one email at a...
 
spoof emaileremail spooferemail sendingemail studiojoke emailerbugmail
ACX MailOut pro

Shareware by ACX-Software
13 x 5794Kb downloads

...MailOut can send personal text and HTML series emails and transmitting. The email - Addresses become with additional information (like address, first name etc..) in an internal data base stored. These...
 
newslettermassmailnewslettertoolsslspamtoolsend newslettermailbombernewsletter softwareserialmailnewsletter programemail marketingserial emailscreate newsletters
...CompleteFTP is a high performance Windows FTP server supporting secure FTP via FTPS (FTP over SSL), SFTP (FTP over SSH), HTTP, HTTPS and SCP. Features include remote administration, virtual file...
 
httpsftpssftpsecure ftpserverwindowsscp
Ldap Admin Tool

Shareware by LDAPSoft
3 x 24438Kb downloads

...Browsing 3. Drag and Drop 4. Search 5. SSL support 6. LDAP Bind/Rebind 7. SQL Syntax Search...import 8. Less Strain on directory servers 9. SSL Support 10. Copy or Move entries across directories...
 
active directory browserldap toolnavigate ldapactive directory adminmanage ldapldap windowseasy ldapldap browserldap explorerldap directory clientactive directory toolldap clientbrowse ldapldap linuxactive directory editor
MailOUT

Shareware by IN MEDIA KG
17 x 5794Kb downloads

...Tool for Serial Emails and Email Marketing. Create newsletters, Send newsletter, Create serial emails and...
 
newsletter programserial emailssslsend newsletterspamtoolemail marketingmassmailmailbombercreate newslettersserialmailnewsletter softwarenewslettertool
Auto FTP Manager

Shareware by DeskShare
25 x 6973Kb downloads

Free Vista Files award
...Auto FTP Manager is a powerful FTP client with support for FTP and FTP/SSL. Use it for web site publishing and maintenance, uploading and downloading files and backing up...
 
synchronize directoriesftpscommand line ftpscriptauto ftp managerftp sslfile transferfilterqueueautomate ftpscript ftpschedule transfersecure ftp
LogMeIn Free

Freeware by LogMeIn
3 x 15574Kb downloads

...LogMeIn Free includes: access from any Internet-connected Web browser; access to a Windows PC or Mac, remote control and desktop viewing, copy and paste between computers, Wake on LAN,...
 
remote managementremote desktopqualityremote controlteamviewerfile transferremote access
...pop-ups, or adware and is completely secure with SSL domain. Compare features: BidRobot supports mature auctions, car...pop-ups or adware and uses a completely secure SSL domain. BidRobot hides your eBay bids from competing...
 
auctionsniperebaybidderbiddingtool
...gives full support of Internet-Standard communication protocols TN5250E, SSL 2/3 and TLS 1. z/Scope Express 5250 was...quickly and easily through tabs. * Support for SSL 2.0, and 3.0 as well as TLS 1.0...
 
5250 emulationterminal emulationibmmainframe400encryptioniserieshtmlas400terminal emulatorzscopesecuretn5250
...Raven is an Integrated ( everything designed to work together ) WEB, POP3, SMTP, FTP, LIST, NNTP, ECHO, and IDENT server that provides a superior combination of stability, security, and scalability. NOTE:...
 
webnntpserversmtppop3
Free Vista Files award
...WebXQ is a full featured stand alone Web Server with a multitude of enterprise level features including support for multi-homed machines, the ability to run as a service under...
 
ncsaweb serverweb pagehttp serverisphtmlinternet serverw3c extendedsslonlineintranetweb hostingsecuretcpipauthenticate
G-Lock EasyMail

Shareware by G-Lock Software
5 x 20173Kb downloads

...G-Lock EasyMail is a professional bulk email sender software for targeted email lists building and bulk email campaigns creating at your own computer. You can easily manage opt-in...
 
listsbulksoftwareeasymailemailcheckmarketingg-locknewslettersmailingmanage
PopTransAct

Shareware by BitDaddys Corp.
16 x 608Kb downloads

Free Vista Files award
...Execution from the System Tray, Port Selection , SSL Support, Powerful replacement parameters and `Headers Only Option`...
 
transfergmailpop3atuomaticserviceextractsslattachmentsaction
...IntegralFTP is a Javascript secure FTP client library. It allows web developers to embed a fully featured FTP GUI client directly into their web pages. IntegralFTP is fully customizable, as...
 
javascriptsecurelibraryftp
LiteWeb

Shareware by Perception
27 x 1293Kb downloads

...LiteWeb is a powerful web server has CGI and ISAPI support, multiple domains, virtual paths, authentication, directory listings, MIME type editor, CGI interpretor editor, Server Side Includes, and user pages (...
 
litewebperltelnetftpphpsslemailisapiserver side includescgihttpmimepop3smtp
Auto FTP Manager Download

Freeware by Adware.us
3 x 4471Kb downloads

...Auto FTP Manager,powerful FTP client with support for FTP and FTP/SSL. Use it for web site publishing and maintenance, uploading and downloading files and backing up servers. With...
 
synchronizesoftwareschedule transferutilitiesautomate ftpftp sslqueueauto ftp managerftpssecure ftpdirectoriescommand lineprogramfile transferfilterscriptwindowsscript ftpcommand line ftp
Troi URL Plug-in for FileMaker Pro

Shareware by Troi Automatisering
14 x 1600Kb downloads

...data - use a secure connection (HTTPS) using SSL - get access to password protected web pages...
 
securewebfilemakeronlinesearchurlinternetplug-inhttpsintranetpostdatabaseformsssl