Sort by : ReleasedNameDownloadsAddedRatingRelevance
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
452 x 1719Kb downloads

Free Vista Files award
...live audio, MP3 music and photos over the Internet ! The Internet Broadcasting Server is a software...a potentially large audience, using a standard web server as a bandwidth amplifier. All you need to...start your own Internet broadcast is this program, and the ability to...site. The disk space used in the web server is always less than 5 MB, even if...and music, BS-Tuner has no "Save" feature.
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
XP Lan Pro

Freeware by Apnasoft Technologies
220 x 2021Kb downloads

...MAC address of LAN card, Host Name Determination, Subnet Mask of your network, DNS Server, DHCP Server,...
 
network informationxplanpro
Scannet Pro

Shareware by Profiler3d
294 x 11118Kb downloads

...Network Monitor,Intern Firewall.Trace route,Shows release,Lists devices and network services,observing network release,observing all ports,direct access on all...for ports ore IP adress location.observing of all network releases, also all background connections of exchange programms...like Kazaa or Emule, Netmeetings and chatsystems like ICQ and Yahoo.It shows exact...information, Hard and Software Inventary,Decoding Files .
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
120 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated...integration with existing directory services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook

Freeware by Adiscon GmbH
78 x 100Kb downloads

...Adiscon logger is an UNIX-like logger command line tool for Windows. It is a re-write of the UNIX logger tool with enhanced functionality. All the popular UNIX options...
 
syslogwindowsunixlinuxcommand linelogger

Freeware by VitalTech Group
199 x 756Kb downloads

...VitalTech IPCalculator is an easy-to-use IP subnet calculator that lets you to calculate every aspect...of your subnet configuration in a few mouse clicks. It takes...an IP address and netmask and calculates the resulting broadcast, network, Cisco wildcard...to be a teaching tool and presents the subnetting results as easy-to-understand binary values. The maximum possible...number of Subnets and Hosts are calculated for a given IP...
 
networkmaskbitsubnetserversolvecalculator
SPAM Shredder

Freeware by Safe Soft Corporation
110 x 1269Kb downloads

...you remove spam emails just from the mail server without pulling them down into your Inbox. SPAM...
 
clientencryptsecuritye-mailsafepublic keyexpressemailspamprotect
Paessler URL Recorder

Freeware by Paessler AG
91 x 740Kb downloads

...strings that a user sends to a web server while surfing a sequence of URLs. It works...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Free Download Manager

Freeware by FreeDownloadManager.ORG
1047 x 7039Kb downloads

Free Vista Files award
...files or whole web sites from any remote server via HTTP, HTTPS, FTP and BitTorrent up to...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...SQLWriter is a powerful SQL script editor for all database developers and database...administrators. It supports ACCESS, SQL SERVER, ORACLE, DB2, SYBASE, MYSQL, FIREBIRD and others....In addition, it also edits or runs SQL queries and scripts with code completion. You can...browse the SQL result data and objects of any database. You...the database template to customize everything´╝ü So this SQL tool can help you work more efficiently.
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
Mach5 PopMonger Regular

Freeware by Mach5 Development
74 x 2782Kb downloads

Free Vista Files award
...up with any POP3, IMAP, or Microsoft Exchange Server (MAPI) mailbox, and runs in the background. It...
 
managementexchangenewsletterbulkfailureunsubscribenotificationbouncecustomeremaildatabaselistpersonalizedpop3mapiscriptingautoreplymailingsundeliverableimapmessage
FastStats Analyzer Free

Freeware by Mach5 Development
90 x 2851Kb downloads

Free Vista Files award
...Super-fast site log file analysis with SmartDNS lookup. Choose from three licenses: a useful FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest...
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
Time Zones Clock

Freeware by Galleon Systems Ltd
177 x 362Kb downloads

...Running on your PC Time Zone Clock will show you the local time of over 300 cities around the world. Simply select the cities you want to display the local...
 
rugby time serverclocktime zonesntp time serveratomic clock
LCP

Freeware by LCPSoft
235 x 2340Kb downloads

...Password auditing and recovery tool for Windows NT/2000/XP/2003. Accounts information import: import from local computer, import from remote computer, import from SAM file, import from .LC file,...
 
securityrecoverysyskeyadministratorpasswordssystemauditwindows
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP...relay server and scans your incoming and/or outgoing mail for...set up multiple profiles for POP and SMTP servers and switch between them from the system tray....
 
internetutilitiesmail headermail headers
AdventNet ManageEngine OpUtils

Freeware by AdventNet Inc.
136 x 26624Kb downloads

...The IP Address Manager tool automatically discovers the subnets from the routing tables and scan them periodically...it also provides various tools for Bandwidth Monitoring, Network Monitoring, Wake on LAN, Detect Rogue Devices in...Management, MAC-IP Resolver, SNMP Trap Receiver and more. AdventNet ManageEngine OpUtils provides real-time monitoring tools to troubleshoot...poor network performance, heavy bandwidth utilization and connectivity or link...
 
cisco router monitoringnetwork monitoringbandwidth monitoringnetwork toolscpu monitorsystem utilitiesswitch port mappingaddress monitoringmemory utilizationnetwork utilitiesdiagnostic tools

Freeware by Carson E. White
147 x 26119Kb downloads

...Grids that are all printable. And a free internet version family tree builder at www.winloft.com. Includes conversions...most popular databases, such as MS Access, MS SQL Server,IBM DB2, Oracle, etc. Customizeable charts and Grids,...
 
genealogytreedatabasesoftwarefamily
ManageEngine Applications Manager

Freeware by ZOHO Corp.
106 x 49152Kb downloads

...application monitoring. Applications Manager proactively monitors applications and servers and notifies problems in network through e-mail/SMS. It...higher availability and optimized performance of your application servers through Microsoft .NET Monitoring, Oracle Application Server, JBoss...The databases that are supported are MySQL, Oracle, SQL Server, Sybase, PostgreSQL, memcached and DB2. Server Monitoring...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
InstantCharts Messenger for Traders

Freeware by ASSISTANCE LLC.
82 x 2082Kb downloads

...allows in creating gateways to join any messaging networks with users from AIM/ICQ/MSN/Yahoo. Its Jabber Technology even...
 
quotejavajabberstocknysemsnyahoomessengerchartsxmppicqinstant
Portello Online SiteEditor

Shareware by Portello AB
69 x 5821Kb downloads

...your web site. Portello is a plug-in to Internet Explorer that puts your page into an editable...is needed. Since Portello is a plug-in to Internet Explorer, you do not have to keep track...used with any web hotel, no matter what WebServer the web hotel uses. Unlike common CMS tools,...
 
homepage editingweb publishingspell checkingsimpledatabasescmscontent management systemweb editorweb browserhomepagesweb editing