1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...Software602 Groupware Server is a secure messaging and web collaboration server...SMTP/IMAP/POP3/LDAP services, corporate Instant Messaging (XMPP) with searchable SQL based archive, web collaboration client along with integrated...integration with existing directory services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for...standard public key encryption and signing of e-mail encapsulated in S/MIME is...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
FREE CompuSec

Freeware by CE-Infosys Pte Ltd
171 x 20800Kb downloads

Free Vista Files award
...provides other software components such as Identity Management, Encryption of Server Files & Subdirectories – SafeLan, Encryption...of individual Files - DataCrypt, Encryption of diskettes, CD/DVD and removable media - CDCrypt,...Encryption of Voice Communication – [ClosedTalk] and Container Encryption - [DriveCrypt] using strong AES algorithm 256 bit...the need to encrypt entire hard disk.
 
secure internet callsencryptscddvd encryptionfree callsdata encryptionauthenticationaccess controlfree computer callstabletprotectionsecure communicationvoipsecurity
Tunnelier

Freeware by Bitvise Limited
152 x 4336Kb downloads

Free Vista Files award
...support for single-click Remote Desktop forwarding for graphical server access. Supports public key user authentication, as well...variety of command line parameters. Ideal for remote server administration using SSH - implements a complete set...
 
vt100port forwardingvt-100sockstunnelingsecureterminalxtermfreedynamicsftpgssapiproxybvtermremote desktopfile transferconsolekerberosencryptedpublic keyssh2encryptiontelnetsecurity
SimpleDesktop

Freeware by Moog Software
134 x 18000Kb downloads

Free Vista Files award
...windowed remote control a breeze. Complete strong session encryption ensures your privacy and HTTP proxied connections allow...access in even the most restrictive networks. Server and router IP address upload ensures long term...DHCP dynamic-ip internet connections and the browser accessible server allows a quick download of a multi-platform client...demonstrations a dream.
 
http proxyremote accessremote control softwareremote computer controlremote administrationtelecommutingremote administrator
Free Vista Files award
...Cryptainer LE Ttotally free 448 bit disk encryption software. Simple, easy to use encryption application that...
 
drive encryptionfile encryptionusb encryptionfolder encryptionpassword protectfolder lockwindows encryptionencryption softwarehide filesdata securitydata encryptiondisk encryptiondata protectionencryption program
Remote Control PRO

Shareware by Alchemy Lab
90 x 1910Kb downloads

Free Vista Files award
...Complete and efficient remote control solution that gives you full control over remote computer as if you were working directly at it - viewing/controlling remote desktop, running windows and console...
 
remote control softwareremote shutdownterminal serverremote accessremote administratorremote desktop
Acubix PicoBackup for Outlook Express

Freeware by Acubix
66 x 3453Kb downloads

...PicoBackup Outlook Express Edition is an easy-to-use Outlook Express emails backup utility packed with many powerful features.Various methods of backup like full backup, incremental backup and multi-...
 
restoreaesblowfishsecuritycompressbackupburningencryptionemailoutlookdecompressdvdftpexpresszip
...transfered data are scrambled using on-the-fly 128-bit AES encryption with random session keys, without need of SSL...security is provided in two different modes: symmetric encryption with shared secret key and asymmetric encryption with...Library can be used both on client and server side, with centralized management of all connections. Information...
 
securenetworkingencryptionprivate
...Set up a VPN server in less than 1 minute. Free client software....Using powerful 256-bit AES encryption technology, the iOpus Private Internet Gateway (iPIG) creates...but all the way to iOpus` secure connection servers deep in the Internet. This ensures that your...client or chat software and switch the iPig encryption on: iPig grabs all Internet traffic before it...
 
secure accessserverwpapublic hotspotaesproxysshnetworkwi-fiwlan80211 abgencryptionsslwepsecurityopenwifivpnwireless
...in real-time, while the operation is running. The server is able to perform remote file compression and...security is provided in two different modes: symmetric encryption with shared secret key and asymmetric encryptionwith 1024-bit...
 
sharingprivatelibrariessecurefile
TipicIM

Freeware by Tipic, Inc.
76 x 4324Kb downloads

...TipicIM can be used with the TIMP IM server or any XMPP/Jabber Compliant Server and is available...
 
instant messagingtipicimjabber xmppvoipwebcamvoice callskype
AxCrypt

Freeware by Axantum Software AB
66 x 3413Kb downloads

...Password protection for files using strong encryption for Windows 2003/XP/Vista/7/2008 using the AES algorithm with...128-bit keys. It combines strong symmetric encryption with compression and double-click editing/viewing. Encrypted files have...that really set it apart from other file encryption tools, commercial as well as free: - Double-click...
 
gplopen sourceapiencryptserverencryptiongnushell extensionfilewindowsaesfreescriptmultiple backup

Freeware by IRCXpro
53 x 6662Kb downloads

...full Windows Domain integration using NTLM and SSL Encryption support (for both Client to Server and User...
 
chattalkircdconferenceircxmirc
SecExMail SOHO

Freeware by Bytefusion Ltd.
17 x 2667Kb downloads

Free Vista Files award
...Free email encryption utility for personal and corporate use. SecExMail works...
 
secure emaile-mail encryptionsecure e-mailfree email encryption
x Chat Free

Freeware by xStudio.ca
86 x 3630Kb downloads

...It uses TCP P2P connection, no interruption from server down. It is a very interactive program and...
 
tts chatnetwork chattext chatnetwork utilities
Recovery for SQL Anywhere

Demo by OfficeRecovery
12 x 4661Kb downloads

...Repairs corrupted SQL Anywhere Server databases (.db). Supported SQL Anywhere Server versions: 9.x, 10.x, 11.x. The recovered...data is saved into a set of SQL files to be used for rebuilding SQL Anywhere...keys, Recovers unencrypted databases and databases with Simple encryption type, Recovered data is saved in ASCII scripts...
 
fix sql anywheresybase anywhere recoverysql anywhere repairsql anywhere restoresql anywhere recoverrestore sql anywherecorruptsybase sql anywhere corruptdamaged sql anywhererecover sql anywherecorrupt sybase sql anywherecorrupted sybase sql any
...security is provided in two different modes: symmetric encryption with shared secret key and asymmetric encryption with...agent acts as both a client and a server at the same time. Fine grained access control...to run search operation on the peers. The server module is able to perform file compression and...
 
securepeer-to-peerprivate
UltraVNC

Open source by UltraVNC Team
131 x 3300Kb downloads

Free Vista Files award
...connection. UltraVNC key features include FileTransfer, Video Driver, Encryption Plugins, MS Logon, high performances over all kinds...connections, Viewer Toolbar, JavaViewer with FileTransfer, autoscaling and serverside scaling, Multiple Monitors support, Repeater/proxy support, good Security...
 
freeware
MyDiskServer

Freeware by Michael Gardiner
155 x 250Kb downloads

Free Vista Files award
...mobile phones. Supports multiple user accounts and SSL encryption for secure data transfers. Can automatically generate zip...audio). Also supports file uploading of unlimited size. MyDiskServer helps configure your computer for sharing files online...be accessible from any device on the Internet. MyDiskServer runs on personal computers (Windows, Linux, Mac etc)...server, remote IP address management and webstart technologies, MyDiskServer creates the...
 
streamsimplejavautilityhost yourselfhostingmydiskserverwebservershareapplicationsharingzipphotosfilessoftwaremusicgallery
Backup4all Professional

Shareware by Softland
27 x 82857Kb downloads

Free Vista Files award
...allows you to encrypt your backup using AES Encryption (128/192/256-bit) and does block backups. This backup program...
 
zip encryptionfirewireftp backupdifferential backupincremental backupfull backupdata backupmirror backupbackup dvdbackup open filesusb backupbackup softwareoutlook express backupbackup4all