1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...easy task. DragonWAF is capable of blocking any SQL Injection target at database (Oracle, MySQL), DragonSoft offers...against 18 common web application attack methods: 1. SQL Injection 2. Server-Side Include 3. Directory Indexing 4....
 
web application firewallapplication securityweb security
CutLogic 1D

Shareware by TMachines, s.r.o.
4 x 9458Kb downloads

...and reliability – making the most of true SQL database (Firebird) for data protection, security, backup, crash...clipboard and connection strings (MySQL, Oracle, Firebird, MS SQL Server, etc.). · Enhanced data sorting and filtering...
 
layoutcutwoodoptimizedoptimallinearstockutilizationminimizenesting1-dcutting1-dimensionaloptimizationmaterialmaximizeprogramcutlogiccostlengthsolveoptimizercutteroptimizingmetalsoftwarewoodworkingsteelsavewaste
CutLogic 2D

Shareware by TMachines, s.r.o.
5 x 9545Kb downloads

...clipboard and connection strings (MySQL, Oracle, Firebird, MS SQL Server, etc.) · Unmatched versatility and flexibility for...and reliability – making the most of true SQL database (Firebird) for data protection, security, backup, crash...
 
optimalsavematerialcutwoodworking2-dimensionalminimizestocksavingscoststeelsoftwareutilizationnestingoptimizationmaximizemetaloptimizerprogramcuttingsolvecutteroptimizedguillotineoptimizinglayoutcutlogicwaste
DBConvert for Firebird and MySQL

Shareware by DMSoft Technologies
2 x 17787Kb downloads

...DBConvert for Firebird and MySQL is a database migration tool which performs two-way...conversion from Firebird databases to MySQL server and from MySQL to Firebird. The tool...is also applicable for MySQL database migration to another MySQL database and is...of InterBase databases too. DBConvert for Firebird and MySQL provides the bulk of functional capabilities such as...
 
Firebird to mysql mysql to Firebird Firebird to InterBase Interbase to Firebird sql and Firebird sql to InterBase sql to mysql mysql and Firebird database sql database conversion Firebird database conversion InterBase database conversion
DBSync for Firebird and MySQL

Shareware by DMSoft Technologies
2 x 18024Kb downloads

...DBSync for Firebird and MySQL is a database synchronization tool which performs two-way...conversion and synchronization from Firebird databases to MySQL server and from MySQL to Firebird. The tool...is also applicable for MySQL database replication to another MySQL database and is...of InterBase databases too. DBSync for Firebird and MySQL provides the bulk of functional capabilities such as...etc.
 
Firebird to mysql mysql to Firebird Firebird to InterBase Interbase to Firebird sql and Firebird sql to InterBase sql to mysql mysql and Firbird database sql database conversion Firebird dbs synchronization InterBase database conversion
Database E-Mailer

Shareware by BinaryMark
2 x 1075Kb downloads

...from any ODBC-compliant data source like MS Access, SQL Server, Oracle, MySQL, SQLite... Program gives you full...
 
campaignaccessmysqltrackemailduplicatesql serverhtmlsqlitebccodbcstationaryoraclesmtptemplatesdatabasesend e-mail
...Oracle to MySQL database converter is simple yet powerful application program...to export and import data between Oracle and MySQL server. Oracle to MySQL converter to converts data...source columns to target table columns. Oracle to MySQL migration utility provides a framework that enables you...to quickly migrate your Oracle database into MySQL database using a wizard driven interface. Oracle to...successfully complete a database conversions project.
 
recordstranslatessourcecolumnsmappingapplicationmysqltransferringrowsoracleprimarydatardbmssoftwarekeyutilityformatsconverterprogramtransformationfilestargettablesconstraintsdatabaseconvertsserver
Connection String Test Software

Shareware by Sobolsoft
3 x 1040Kb downloads

...database connection strings for multiple databases. Databases include: SQL Server, MySQL, Informix, Oracle, PostreSQL, IBM DB2, Sybase,...Progress, AS/400, Firebird, Paradox, Interbase, SQLite, FoxPro, SQL Azure, SharePoint, Exchange, Lotus Notes, OLAP, Access, Intuit...
 
dbaseserverscheckingconfigprogrammaticallysystemssyntaxtesterprogrammingbasicaccesstestingconnectingview collationsphysical statusstrengthdatabaseconnection stringrun enginesadovalidating
idxScout

Shareware by idxSoft LLC
3 x 836Kb downloads

...Find Foreign Keys. Effortless Data Models. SQL Made Simple. Attention Developers, Crystal Report Professionals and...Download it at www.idxSoft.com. Point it to your SQL Server, Access, MySQL, Oracle or DBF database. Run...design problems. Check a box and build an SQL Select. Write SQL joins mistake-proof. Modern databases may...fields; you`ll be surprised what idxScout finds. Use SQL Workshop and write select statements fast. Just check...
 
idxscoutdbfsql joinsjetdatabasedata analystsrelationshipsforeign keysdevelopersdata modelingidxsoftsql selectaccessindexessql serveroraclequeriescrystal reportsmysqlprimary keysstructure
Email Validation Tool

Shareware by troyeesoft.com
5 x 1454Kb downloads

...DBase, Excel, Lotus 1-2-3, QuattroPro, MS SQL, Oracle, MySQL and MS Access or address books etc.) to...
 
verify email addressemail cleaneremail validatoremail validation softwareemail verification toolemail list managementdomain validation programbulk e-mail verifiercheck domain
Localtransformer

Shareware by 4dots Software
2 x 8506Kb downloads

...3.5 XAML files * Database Localization (Oracle, Microsoft SQL Server 2005, MySql , Microsoft Access etc.) *...
 
translatorcomputer aided translationinternationalisationinternationalizationsoftware localizationdocument localizationdatabase localizationl10nlocalization toollocalisationi18ndatabases localization
...Cost effective MySQL database to MS Excel converter offers an easy...platform to merge converted MySQL database records with existing MS Excel data without...considering working of conversion process. MySQL to MS Excel db converter utility has inbuilt...perform accurate and efficient conversion of database records. MySQL to MS Excel database transformer is provided with...let you edit, delete or update database entries.
 
servertoolexportprogramspreadsheetindexesmigrationdatabaseworksheetimportconstraintsrecordssourcecolumnskeysutilityattributestablesprimarymergemoveapplicationsoftwaretranslationmysqlexcelrows
KlassBuilder

Shareware by KazMax Ltd
3 x 2715Kb downloads

...the database tier of multi-tier development environments. Supports SQL Server, MySql, SQLite and other database technologies. Template...
 
source codevbnetgeneratorbuilderdatabaseclassdevelopment
ABIS Query

Shareware by BOS-Software Sàrl
2 x 15552Kb downloads

...the drag & drop, you automatically create any SQL requests even the more complex ones. The integrated...designer helps you re-design previous SQL scritps. Installed with integrated connectors to Oracle, MS-SQL,...MySQL, PostgreSQL and ODBC drivers, ABIS-Query lets you immediately request...
 
sql scriptxsdstored proceduremysqlmssqlsql builderaccessquery builderdatabase tooldbmsodbcsql designerms-sqlserverxmloracleintegrated data-providersms-excelpostgresql
...as FTP, Email: POP3 and SMTP, File operations, SQL scripts, Zip and Unzip, ETL Task scheduler and...Excel, Access, DBF, Foxpro, ODBC, OLE DB, MS Sql Server, Oracle, MySql, PostgreSQL, Firebird, Interbase, SQLite, POP3,...it into the database, run stored procedure or Sql script. Once loading is completed send email to...
 
etlpowerful etl toolsql serverodbcbcpsql loaderdata transformationcomplete business automationoracle
Bainsoft BDB Professional Edition

Shareware by Bainsoft
2 x 7276Kb downloads

...design, modeling & deployment tool. It supports Oracle, SQL Server, MySQL, Access, SQLAnywhere and Sybase. In addition,...BDB is also a great SQL Query Intellisense Tool. Main BDB features: • Database...data. • Inquiry analysis Auto-complete and Intellisense for SQL Query. • SQL script pre-view If there is...the entity database, you can output and update SQL in advance and preview the database rebuilding SQL...
 
modelingbdbtoolmigrationdiagramdeploymentsoftwaredatabasedesign
Aditway

Demo by Brian Hetzel
2 x 31832Kb downloads

...Aditway is a fast and easy-to-use database query tool! Get Up and Running FAST. Try it Free for 30 days! The need for technical expertise to retrieve data...
 
derive connectionsdata miningdata toolquery toolextract datadata warehousedata retrievaldata queryretrieve datasql toolbusiness intelligencedata extraction
...formats and character sets. For the import in MySQL or SQL databases the `CREATE TABLE` script can...
 
sqlconversionviewtransformfreewaregeo datadbaseconverttransformationutfsdfasciiviewertransmutecsvutf8killetsoftansimysqlunicodefile
DBF To SQL Converter Software

Shareware by Sobolsoft
1 x 3034Kb downloads

...Convert one of many DBF files to SQL files. Completely customize the SQL output. DBF files...
 
mysql mssqlexecutetsqlsql file extensiontextdatatxtdatabaseconvertingflat-filet-sqltransact-sqlflatfilesdbf2sqldbf sqlrunning batchsequeldbftosqlscriptopen sql files
...any database and browse or modify data ,run sql scripts, export and print data. There are two...Key Benefits: * Works directly with Oracle, MS Sql Server, ODBC, MySql, OleDB, PostgreSQL, SQLite, MS Sql...CSV, Excel, Html files * Execution history * Sql Builder with wide range of supported databases *...
 
works directly with oracleoledbodbcsqlitesql serverpostgresqlsql server compactmysqlinterbase and firebird