1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Classic WordZap

Freeware by MICA
67 x 284Kb downloads

...Classic WordZap(R) 2.29 is a Freeware word game where you race your computer opponent to create...it is zapped from both lists. . The game is a re-mastered version of the game that...play adapts to your skill to keep the game a constant challenge. . The play provides a...skills in others. . Many people find the game both stimulating and relaxing and get in the...you will love Classic WordZap.
 
typingdictionarypuzzlefastboggleaddictiveactionvocabularyword gameloveeducationalkeyboardingscrabbleaddictionaryquickspelling
Ray`s Letters and Numbers

Freeware by Raylec Software
63 x 772Kb downloads

...keyboard skills and much more. Simple, entertaining, educational games which your child will want to play again...
 
abcletterspreschoolfree spelling beemathelementarykids gamesalphabet123freewarefree educational gameprimarycolourscolorsfree kids softwarenumbers
...Free Word Finder game ! This is an fun Hangman type Word...Finder game for teaching children English vocabulary, Words and Spelling....The aim of the free spelling games is to create the given word before the...out, or else the Man becomes hanged. The spelling games is extremely useful to increase general English vocabulary...and vocabulary activities.The spelling games is extremely useful to increase general English vocabulary...
 
finderchildrensspellingkidsgameswordsenglishfreeonlinevocabulary
Cognizance

Freeware by Z2 Games
29 x 4875Kb downloads

...Cognizance is a 2D horizontal shooter game that combines a traditional shooter with puzzle and...
 
word gamesrpgwordsactionspellingpuzzlespellsshooter
3D Word Slider

Shareware by TLK Games
22 x 1767Kb downloads

...A full 3D attractive and colorful word puzzle game in three languages: French, English and Spanish with...180 levels of game with element of strategy and optional sound effects...screen resolution and adjustable letter details make this game easy to learn that offers an excellent visual...
 
spanishenglishplayreadingconstructgamestrategysliderspellinglanguagescreatewordvocabularypuzzlefrench
Spellcaster

Shareware by Superluminal, Inc.
22 x 11476Kb downloads

...Spellcaster takes the word game genre to a whole new plane of existence....
 
crosswordspellingpuzzleletterspellcaster
Dino Trilogy

Shareware by DynoTech Software
29 x 1885Kb downloads

...Get three exciting educational games for ages 5-12 at single low price: Dino...Skills), and Dino Spell (Spelling Practice). These Windows games have been optimized to work with Windows 9x...child never looses points or bonus items. Each game consists of 10 progressively more difficult mazes. Children...difficulty to produce 30 different mazes in each game (total of 90 mazes). The ultimate goal is...
 
dynotechrexlearningelementarydinosaursfunchildrenthinkingmusicmatchingimprovearithmeticschoolsolvingmathnumberstyrannosaurusderikkidseducationalevaluatingtestingspellingwords
...Schoolhouse Bingo you can easily create educational bingo games to support and reinforce lessons in any area...of the curriculum. Design game activities to enhance learning in mathematics, language arts,...welcome a change of pace. Select from auto-generated games that include Basic Arithmetic Facts and Operations, Roman...can easily create your own. Then save the games for future use. Select between having your students...the game.
 
spellinglanguageteachervocabularymathtoolbingo

Shareware by Fonlow IT
31 x 1816Kb downloads

...key and finger to be used. A typing game is for fun break. All practice contents are...
 
singlerussiangermanfingerspellingdictionarytypinghandeddvorakspanishkeyboardtutor
LearnWords Windows

Shareware by LearnWords Software
25 x 6195Kb downloads

Free Vista Files award
...Features: - transcription and pronunciation of words - games and amazing forms of levels of study -...- different exercises makes process of study in game and amazing forms; - the sequence of exercises...(stable associations "word & translation", "translation & word", spelling and other). LearnWords has all opportunities for fast,...
 
wordphraselanguagelearnpronunciationwordseasygrammarstudyexercisetranscriptionfast
WordWhiz Solitaire

Shareware by Skye Publications
18 x 2441Kb downloads

...very addictive and very fun word solitaire card game that will provide countless hours of word fun...educational value you will receive by playing this game will make the small investment to purchase your...75,000 common word dictionary that is included. The game begins with an automated shuffle of all 98...on the playing surface. The object of the game is to use all 98 cards in the...
 
word gamespelling gameword solitairewordwhiz solitairecard game
Spell Chaser

Shareware by G&R Cybermedia Group
21 x 6126Kb downloads

...Spell Chaser is an educational game that is really FUN! While it teaches spelling...solving skills. It is written in the classic game style and is so much fun, kids will...before it is too late. You move the game piece around the screen going up and down...
 
educationalspellinglearningcomputer software gamesclassic
WordZap Deluxe

Shareware by MICA
48 x 46594Kb downloads

Free Vista Files award
...WordZap(R) 7.14 is a Shareware word game where you race your computer opponent to create...graphics and a variety of additional `motifs`. Four game options are available: EasyZap, LongZap, WordZap and MatchZap,...called "Sudden Death" makes for even more exciting game play. Extra word lists will satisfy the most...Scrabble you will love WordZap. WordZap(R) - The Game Everyone Loves! Better than Boggle -- Faster than...
 
vocabularyswedishaddictivetypingpuzzleactionitalianfastboggleloveword gameportuguesedictionaryenglishdanishquickeducationalgermanscrabbledutchspellingkeyboardingaddictionaryfrench
Enigmacross

Shareware by Crossdown
24 x 3428Kb downloads

...systems. You can also generate standalone puzzle "player" game applications which can be run and solved on...
 
acrosticsgamestriviaword gamesreadingpuzzlesvocabularyspellingacrostic puzzles
...Revolutionary educational game! Great fun while learning new facts! Now you can become knowledge guru. Learn spelling, irregular verbs, chemical element symbols, famous persons, capital cities, country flags and much...
 
educational gamefreechildrenmemory gamekids gameseducation gamelearningeducation playlearning gameeducational programdrill gametest gameeducational software
Animated Beginning Phonics

Shareware by Flix Productions
27 x 11529Kb downloads

...certain number of problems they can visit the game room with puzzles and matching games (animated of...course). The game room has a parent/teacher control so the number...
 
vowel soundsreadingconsonantsspellingphonicswordsvowels
Animated Spelling

Shareware by Flix Productions
29 x 3362Kb downloads

...The "Animated Spelling CD" has over 700 words (with sound) and...animations (over 120 Meg!). The program has two games - a matching game where the child can...to a word on the screen, and a spelling game where the student hears the word, then spells...
 
englishletterslanguagespellingwords
Spellarama

Freeware by Spellarama
32 x 8495Kb downloads

...parents or students can create self testing board games for free. Comes with Solitaire-Mania card game and...a default Grammar and Spelling board game file....
 
languagespellingteachereducationkidsliteracyhomeschoolk-12
Stratavon

Shareware by Hulett Soft
22 x 3194Kb downloads

...then you will almost certainly like playing the game stratavon. The play is similar to Wheel Of...never lock up so you can evaluate the game for as long as you like. Stratavon is...letters and solving word puzzles to win a game of stratavon. It takes calculated planning, risk, and...
 
spellingkidswordfamilyfortunelettersphraseshangmanpuzzleboard
...Wordigo is the popular board game that`s now in 950 stores across the country....It`s a combination of a spelling game and a crossword puzzle. If you like word...
 
actionpuzzlesword gamescardsmultiplayermahjongsolitairespellingsharewarecasual gamescrossword puzzlefree downloadsfreewarefree game downloadspokerscrabbleonlinebook worm