1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
yMail

Freeware by Spacejock Software
56 x 3096Kb downloads

Free Vista Files award
...yMail can be used as a spam cleaner for your existing email setup, and also as...a standalone email client. yMail`s spam filters use Bayesian techniques. You can show yMail...which messages are spam and which are not (before you even download...just use yMail to preview and automatically delete spam before downloading into your regular email software. Free...
 
pop3offlineclientspambayesianemailstandalonefiltercleaner
All in One SECRETMAKER

Freeware by secretmaker team
133 x 1249Kb downloads

...tools: a security watchdog, a intruder blocker, a spam fighter, a pop-up blocker, a banner blocker, a...Intruder blocker protects from Spyware, Trackware and Viruses. Spam Fighter rates spam, works with any POP3 e-mail...Various white lists allow user-specific optimizations. The history cleaner clears needless files, logs, and tracks. All-in-One Secretmaker...
 
worm hunterbanner blockerspam fighterhistory cleanerpopup killerprivacy protectorcookie eraserintruder blocker
...exposure. This can generate in a wave of spam targeting your private email addresses and offering either...
 
cleanersnoops attackremove spywarehijackeranti hackeranti trojanvirus removalanti-viruswormtrojansspyware removerprotectparasitesfree spyware removalmalware threatexploitbackdoorfloodadware removersecurity
POP3 Sweeper

Shareware by Devicode Technology
17 x 1171Kb downloads

...create powerful rules to automate the deletion of spam mails from your mailbox. POPSweeper allows you to...set up a variety of spam filtering rules based on the sender, recipient, subject,...Create advanced rules based on regular expressions. - Spam filter, anti spam, junk mail filter, email filter...
 
large emailpopsweeperpop sweeperunsolicited emailmailboxanti-spamremove spamanti spamemail filterpop3junk mail removerimappop cleanerspam filterunwanted emails
...Open Sesame Spam Blocker is a Windows software program that deletes...folder). When the email is deleted, Open Sesame Spam Blocker can send an email (if you wish)...subject line in order to have Open Sesame Spam Blocker not delete the email. While it may...password that enables them to bypass Open Sesame Spam Blocker, there is actually a very logical reason...for this. Almost all spam is sent out in bulk by computer programs....they never even see the reply.
 
spam scrubberspam cleanerwhite listspam blockerantispamstop spampasswordanti-spam
...get rid of particularly nasty spyware components. Spy Cleaner Gold stands out in the spyware-removal field, but...honesty when dealing with nasty infections makes Spy Cleaner Gold a worthwhile purchase....
 
tsadbotaureateprivacyonflowspamdllspywareradiatead-waretimesinkspycleanerwebhanceradwareconducentadvertising trojansad-supported software
Spam Monitor

Shareware by PC Tools
13 x 10626Kb downloads

...Spam Monitor is an easy-to-use spam filter that detects and isolates unsolicited junk mail...mailbox. Designed for people that aren`t computer experts, Spam Monitor`s powerful wizard configures your PC with the...
 
junkbayesianmailcleanerfilterinboxwasheranti spamuce
EMCO Network Malware Cleaner

Shareware by Emco Software Ltd.
24 x 8251Kb downloads

Free Vista Files award
...EMCO Network Malware Cleaner is an intuitive addition in the category of...of the network. Users of EMCO Network Malware Cleaner can also request for the addition of new...keep in mind is that EMCO Network Malware Cleaner is not a real time scan engine rather...machines or not. Main Features of Network Malware Cleaner are described below: Remotely scan and clean EMCO...
 
trojanspamcleaneradwaredialermalwareviruswormscanner
Kingsoft Internet Security

Shareware by BinaryNow, Inc.
7 x 54909Kb downloads

...Kingsoft AntiVirus provides real-time checking of files currently being used on your computer. It is small in size and will not slow down your system nor require you to...
 
diskphisingantivirusprocessantimalwareriskwareantiphisinglspsystembrowseranti-spywarerootkitdemandtrojanrepaircleaneraccessbhofirewallscannerantispywarevulnerabilitywebshieldanti-virus
POP3 Cleaner PRO

Shareware by ACMEtoolz.com
12 x 360Kb downloads

...size and the date it was received. POP3 Cleaner PRO can also run fully automated on the...
 
windowscleaningfilteringpop3cleanermailboxe-mailantispamanti-spam
All Tracks Gone Internet privacy Cop

Shareware by A1Tech, Inc.
11 x 2000Kb downloads

...AllTracksGone Internet privacy history cache registry clean window washer automatically cleans your computer of files you may not want others to see, protecting your privacy. Features: Automatic- You can schedule...
 
killerantispamweb washeranti-spamwindow washerhistoryerasejunkpreventblockerstopwebwasherspam emailcachecleaner
Asmw PC-Optimizer pro

Freeware by asmwsoft.com
23 x 7478Kb downloads

...executable files and folder lock; menu guard; IP Spam Messages Blocker, system information and much more… Your...
 
ram optimizerorganizeraddressempty foldertweakdecrypthistorybootboostinstallhealregistrytunecookiescatalogmaintenanceencryptcleansettingsshredinternetspeedfixdiskreportsecurityfontstartshortcuttracks erase
Spyware Cure Software

Demo by Portalshops
13 x 2073Kb downloads

...Spyware cleaner software scans and detects spyware programs, adware, malware,...trojans, keyloggers and other destructive worms. Spyware Cleaner will scan, detect and clean your computer from...computer, change configurations of your computer, send you spam emails, record each keystroke you type and send...it to thieves. Spyware cleaner comes with over 50000 defination keys that detects...with updates that can be downloaded occassionally.
 
spyware fixspyware cleaneradware removerspyware scanmalware removerfree spyware removerspyware sweeper
Ashampoo AntiSpyWare 2

Shareware by ashampoo GmbH & Co. KG
273 x 45158Kb downloads

Free Vista Files award
...permanently so they cannot be recovered. - IP Spam Blocker: Pop up protection against annoying ads on...
 
trojansecuritytoolspywarewormsrootkitdialerinternet cleanerutilities
Email Validation Tool

Shareware by troyeesoft.com
5 x 1454Kb downloads

...address without sending an actual email. This reduces spam by blocking email and ensures that email addresses...
 
verify email addressemail cleaneremail validatoremail validation softwareemail verification toolemail list managementdomain validation programbulk e-mail verifiercheck domain
Spotmau TuneUp Kit

Shareware by Spotmau Inc
4 x 12357Kb downloads

...Performance, clean and customize your Windows. Windows Speedup: Spam and malicious software messed up your registry every...which badly wastes your precious system resources. Windows Cleaner intellectually and safely clean up your system and...
 
speedfree scanfix slow computercheckwindows optimizeregistry cleancheanerdisk cheanupwindows freezerepaircomputer unstableboost windows startupsystem cleanerwindows cleanerwindows speed
Smart PC Optimizer

Freeware by Anylives
5 x 1224Kb downloads

...up extra hard drive space to achieve a cleaner and faster system. This free computer maintenance software...provides system optimization, registry optimizor, spam file cleanner. Keyfeature about PCLive Computer Tuneup 1.Smarstest,Smallest,Speedest...tune up computer system, one step to clean spam files. 3.The user interface is friend-designed and easy...
 
free tune-up toolspeedestsystem junk cleanerspeed your computersmallestmake your computer fastersystem optimization toolsmartestfree speed-up tool
Anti Tracks Free Edition

Freeware by Giant Matrix Ltd
2 x 4049Kb downloads

...complete disk cleanup, tracks erasing, data protection and SPAM elimination solution to help tidy up your computer`s...and securely save your important passwords and eliminate SPAM before reaching your inbox....
 
password wallettracks eraserspace analyzerduplicate files cleanerjunk files cleaneranti tracks free editiondisk cleaner