1 2

Sort by : ReleasedNameDownloadsAddedRatingRelevance
ManageEngine Applications Manager

Freeware by ZOHO Corp.
107 x 49152Kb downloads

...Monitors enables you to create JMX consoles and SNMP Consoles and to monitor your Java applications or...other applications that expose management information through SNMP & JMX. It enables SLA management by tracking...
 
webspheredatabase query monitoringapachebusiness service managementapplications managementjmxsnmp consoleshp-uxwindowssapccmslinuxvirtualization monitoringweblogicamazon rdsactive directorywebsite monitoringsolarisserver monitoringservice
WebNMS SNMP API - Free Edition

Freeware by ZOHO Corp.
33 x 3209Kb downloads

Free Vista Files award
...WebNMS SNMP API offers a comprehensive development toolkit for SNMP-based...network management applications. WebNMS`s SNMP stack comprises a set of powerful Java SNMP...that are reliable, scalable, and OS independent.The Java SNMP library provides off-the-shelf components for trap and table...handling along with basic SNMP operations, such as SNMP GET, SNMP GETNEXT, SNMP GETBULK, and SNMP SET....
 
snmp v2csnmp forwardingsnmp proxysnmp responsenetwork managementsnmp apiagentsnmp monitoringsnmp operationsnmp trapsnmp request
MIB Browser

Freeware by KS-Soft
36 x 665Kb downloads

...Browser allows you to view the hierarchy of SNMP MIB variables in the form of a tree...and manipulate data that is available in an SNMP agent. MIB Browser may perform SNMP Get and...
 
snmpmib browsermib compilersnmp browser
Acronis True Image Enterprise Server

Demo by Acronis
21 x 188974Kb downloads

Free Vista Files award
...systems Remote unattended restores with the Acronis bootable agent — Recover all systems in the network from...space in storage archives Windows Event Log and SNMP support — Plug into your existing network monitoring...
 
online data backupswindows server 2000 backupremote online backupbackup mail enterprise serverexchange server 2003 backup
NetDecision

Commercial by NetMechanica
21 x 28168Kb downloads

...* LogVision * TFTP Server * TrapVision * SNMP Agent Simulator * SNMP Packet Analyzer * Status propagation....* Events filtering. * SNMP notifications (traps and informs) to events mapping. *...
 
mib browsernetwork managertrapvisiontrap receivertrap simulatorsnmpnetwork management
Global Network Inventory

Shareware by Magneto Software
22 x 10616Kb downloads

Free Vista Files award
...network printers, document centers, etc. Global Network Inventory agent can also be deployed to perform regular audits...the network. In this scenario, Global Network Inventory agent is exported to a shared network directory, and...-Audits can be performed by deploying a scan agent through the domain login script. -Licenses are network-based...
 
auditnetwork inventorysnmpprocessorzero deploymentxmlreportprintersoftware auditagent-freereportingcpuswitchhardware inventoryprintinghtmlinventory systemasset tagsoftware inventorydevice
AdventNet Agent Toolkit C Edition

Commercial by AdventNet Inc.
23 x 43471Kb downloads

...AdventNet Agent Toolkit C Edition is a rapid prototyping and...development tool to build SNMP (SNMP v1, SNMP v2c and SNMP V3) agent, TL1 agent, and...CLI agent in ANSI C. It helps network engineers and...telecom application developers to create standalone or multi-protocol agents with SNMP, TL1, CLI and HTTP support based...on application requirements.
 
agent builderhtml adaptormulti protocol agentembedded agentproxy agentsnmp agentcli adaptortl1 agentcli agentmaster-sub agentagent toolkitdeveloping agents
WebNMS SNMP Agent Toolkit

Commercial by ZOHO Corp.
23 x 36658Kb downloads

...protocol. For example,application server vendors are keen at SNMP for their management needs. Similarly TL1 is a...network management. These needs are fulfilled by WebNMS Agent Toolkit Java Edition which provides the necessary infrastructure,...availability of skilled people and tools. The WebNMS Agent Toolkit Java Edition is a rapid prototyping and...development tool used for building Java based Standalone SNMP and TL1 agents.
 
snmp v2cmulti-protocolsnmp apisnmp responseagent frameworksnmp operationsnmp requestsnmp agentcorba adaptorsnmp traprmi adaptormultiprotocol agentsnmp proxynetwork management
WebNMS Simulation Toolkit

Commercial by Zoho Corporation
34 x 36365Kb downloads

Free Vista Files award
...WebNMS Simulation Tool comprises easy-to-use, GUI-based agent simulator and network simulator for testing, training and...The network simulator enables network simulation of 100,000+ SNMP (v1, v2c, v3), TL1, TFTP, FTP, Telnet and...and Trap Recorder to record and replay real SNMP networks and traps and create simulations of actual...of agent/network behavior and trap generation, customization of SNMP request/response PDUs.
 
network simulationcisco simulatenetwork simulatorcisco ios simulationsnmp simulateagent simulatorsnmp simulatorsnmp agent simulator
Adventnet SNMP Utilities

Commercial by Adventnet Inc.
26 x 25371Kb downloads

...AdventNet SNMP Utilities offers a comprehensive development toolkit for SNMP-based...is very helpful for debugging and testing. The SNMP Utilities has a simple and intuitive graphic user...to perform various functions in a mouse-click. AdventNet SNMP Utilities provides off-the-shelf components for trap and table...handling along with basic SNMP operations, such as SNMP GET, SNMP GETNEXT, SNMP GETBULK, and SNMP SET....
 
utilitiessnmp operationsnmp apisnmp v2csnmp responsesnmp trapsnmp requestsnmp monitoringsnmp forwardingagentsnmp proxynetwork managementtesting tools
GSA Email Spider

Shareware by GSA
66 x 14900Kb downloads

Free Vista Files award
...(like google mail), -Send emails directly with internal snmp server, -Javascript analysis to find protected email addresses,...
 
emailemail-marketinge-mail-marketingemail crawle-marketingcollect emailemail extractemail finderemarketinge-mail marketinggather emailemail grabemail parseremail crawleremail marketingserialmailsemail grabber
Free Vista Files award
...functions of Cisco(r) specific routers and Windows NT4/2000/XP/2003 SNMP agent. General features: supervises the basic and extended...parameters of the router and its interfaces; SNMP GET BULK request can be used; raise alarms...and log SYSLOG messages; receive, analyze and log SNMP traps; repeaters monitoring, control of repeater`s ports; searching...MAC addresses; ping monitoring; TCP connection table monitoring; SNMP parameter history, graph and log; export...
 
alarmciscolanrouteragentalertstatisticsnetworkmanagementsnmpinterface monitorcontrol
...is a MIB Browser and Expert System for SNMP Agent analysis and administration. Supports SNMPv1, SNMPv2c, and SNMPv3....Tools include MIB Browser, MIB Compiler, SNMP Trap Receiver, OID Poller/Graph Utility, SNMP PDU Trace,...and imported directly into OidView`s MIB database. The agent recognition code will automatically determine the correct vendor...for the SNMP agent, and then download and install any available...
 
simulatortrap managerasn1mibwalkengineertechsupportmonitormib browsernetworkinternetmibssnmp trapanalysissnmpv3softwarefault managementpdusnifferoid
Big:eye Pro

Data Only by CBR Software
21 x 116210Kb downloads

...network devices, servers, clients, databases, applications,Fault Management, No agents or clients required, Maps (Auto Discovery),Performance Monitoring,Remote Control,Inventory...management for Windows, Inventory management for SNMP Devices,Web based reports,CISCO device monitoring,MOTOROLA device monitoring,SNMP Device...installing an agent),Analyze and report Windows Event Logs,Distributed SNMP and Service Monitoring Module, Service...
 
switchapplication monitoringremote desktopasset managementchange managementtraffic monitoringservicedesksnmphelpdesktraffic analyzerinventory managementdesktop managementnetwork managementmotorolaciscosniffersyslognetwork monitoring
Big:eye Small Business Edition

Commercial by CBR Software
20 x 97656Kb downloads

...network devices, servers, clients, databases, applications,Fault Management, No agents or clients required, Maps (Auto Discovery),Performance Monitoring,Remote Control,Inventory...management for Windows, Inventory management for SNMP Devices,Web based reports,CISCO device monitoring,MOTOROLA device monitoring,SNMP Device...installing an agent),Analyze and report Windows Event Logs,Distributed SNMP and Service Monitoring Module, Service...
 
syslogdesktop managementapplication monitoringswitchremote desktopinventory managementtraffic monitoringnetwork monitoringsniffertraffic analyzerasset managementciscomotorolanetwork managementsnmpchange management
...Version 1.1 and 1.0 - implemented protocols: SNMPv2c, SNMPv1 - using SNMP commands GET, SET and TRAP...using ICMP ping to manage devices without running SNMP agent and displaying of round trip time as one...possibility to manage max. 15 devices with running SNMP agent - implementation of MIB Browser, which scans SNMP...manageable device for its SNMP variables that correspond to MIB objects (in the...Import from csv files.
 
opcmibmib browsingsnmppingfree demohmisnmp opc servertcpscadaindustrial ethernetsnmp v2csae automationjscriptnetwork monitoringsaeautscanningopc xmlethernet network
Network Inventory Advisor

Freeware by ClearApps Software
85 x 14122Kb downloads

Free Vista Files award
...Network Inventory Advisor is an agent-free utility which brings you fast and reliable PC network inventory. It excellently performs scanning of Windows, Mac OS X and Linux and provides...
 
asset managementcomputer auditnetwork performancenetwork auditingasset trackingnetwork asset trackerinventoryaudit licencesoftware inventorynetwork management softwarehardware inventorynetwork inventory
AggreGate Network Manager

Shareware by Tibbo Technology
16 x 151356Kb downloads

...network performance analysis tools, real-time charting, MIB database, SNMP Traps handling, Syslog server, Windows Event Log consolidation,...It supports all versions of SNMP, including secure SNMP v3, thus allowing management of heterogeneous multi-vendor networks....
 
network monitoringwindowssensor monitoringapplication monitoringrouter monitoringperformance monitoringsnmpunixtraffic monitoringserver monitoringlinuxnetwork managementswitch monitoringciscoservice monitoring
...Solution for integration of the SNMP computer network management and data pre-processing with SCADA...1.0, OPC UA 1.1 - implemented protocols: SNMPv2c, SNMPv1 - using SNMP commands GET, SET and traps...using ICMP ping to manage devices without running SNMP agent and displaying of round trip time as one...to manage unlimited number of devices with running SNMP agent - pre-processing data using JScripts - support of...
 
snmppingjscriptopcscadascanningopc xmlsaeautnetwork monitoringmibethernetsae automationsnmp v2cindustrial ethernetmib browsingsnmp opc serverfree demoethernet networkhmitcp
Network Inventory Advisor

Freeware by ClearApps Software
19 x 14995Kb downloads

...Network Inventory Advisor is an agent-free utility which brings you fast and reliable PC network inventory. It excellently performs scanning of Windows, Mac OS X and Linux and provides...
 
asset managementhardware inventoryauditsoftware inventorynetwork auditingnetwork inventorynetwork performancenetwork management software