1

Sort by : ReleasedNameDownloadsAddedRatingRelevance
RecOnPhone

Freeware by RecOnPhone
87 x 1390Kb downloads

...is provided. You do not require an external SMTP server. Powerful audio editing capabilities included. You can...
 
surveillancephone recordingtelephoneeavesdroprecorderwiretap
PostCast Server Professional

Shareware by Gate Comm Software
65 x 19463Kb downloads

...PostCast Server is an SMTP server program for Windows that enables you to send...messages. You can use it instead of the SMTP server of your Internet Service Provider (ISP). PostCast...and receiving messages can be connected to the server in a very easy way - by altering...
 
newslettere-mail marketingmail serverautorespondersmtp serverfreewaresharewaremail listse-mail mergeemail merge software

Freeware by Sashazur
26 x 226Kb downloads

...email address, LocatePC will automatically enter the correct server address, port, and user name. • LocatePC only...works with SMTP servers that don\`t use SSL (secure sockets layer) or...SPA (secure password authentication). Compatible providers listed above don\`t use either. • Some ISPs...block access to all SMTP servers except their own, and some SMTP servers only...
 
freeware
...all available mailing modes (TO/CC/BCC/Personal Copy) * Built-in SMTP server will let you send e-mail messages to...the recipient`s box bypassing the provider`s SMTP server. * Importing address lists from text and...
 
bulk mailere-mail marketingmail listmass mailer
Email Privacy

Shareware by IM-Soft
19 x 14208Kb downloads

Free Vista Files award
...know that first of all, your Internet Service Provider gets all your email messages, stores them somewhere...on its mail servers and then delivers the messages to your recipients...that someday all the information kept on the servers can be easily used against you? Email Privacy...is a system-tray local SMTP server program for Windows that lets you send email...
 
emailmassbomberaddressmailingsmtpremailerfreebulkbooke-mail
OLfax

Shareware by Quester
50 x 1191Kb downloads

...connect to different fax lines. An integrated POP3/SMTP server allows usage of OLfax without having a separate...mail proxy. If a mail proxy or Exchange Server already exists, OLfax can be configured to be...receive faxes using an AVM FRITZ! at a server via email and Forward incoming faxes via email....automatic publish your web site to any FTP server offers an economical and industries independent Outlook and...
 
network faxfax serveroutlook faxemail faxoutlook-to-faxfax solutionsfax groupwarefax sharingfax softwareavm fritzfax gatewayfax clientfax-to-mailfax toolsmail-to-faxfritz cardinternet faxfax-to-outlook
Email Manager

Shareware by Mail Tools
5 x 4681Kb downloads

...email, ask for receipt confirmation, find the faster SMTP server of your provider, retrieve the list of...commands accepted by your SMTP server, email address syntax verification, chameleon behavior with...your SMTP server, timing options, completely customizable and more, it`s...
 
very fastnumbermailerlargeemailingfreemarketingnotificationadvertisinginformationmanagerprofessionaltrialutilitiesrecipientslistfasterextractormassbulkharvestersoftware
Advanced Mass Sender

Demo by KBB Software, LLC
703 x 3821Kb downloads

...AMS the best email marketing program today. Build-in Smtp server, powerful, supporting packet-sending emails without using the...smtp server of your provider allows you do send up to 500 emails...modem. The unique ability to send through several smtp servers simultaneously allows you to send up to...List Validator 1.1 which allows you checking the server for the existance of the email. AMS has...
 
internet businessbulk email softwarebulk marketingmass email softwareemail marketingdnsproxymass mailemails marketing softwareamsfree downloadadvanced mass sendersmtpbulk email sendermarketing bulk mailermail list validator
...sender profiles. Add, update or delete profiles. Bypass server SMTP settings to send emails anonymously. Use standard...SMTP server to send emails with account authentication. Settings can...requirements –for more advanced functionality. Database Import: Select provider ( MS-Access, SQL-Server etc.) Set you connection string...( Server IP, user name, password) Enter a SELECT query...
 
email marketingnewsletter managementgroup mailemail advertisingemail newslettergroup email senderemail managementbulk maileremail verifiermass mailerbulk mail sendermass email software
5star Mail Server

Shareware by softkeeper.com
30 x 7753Kb downloads

Free Vista Files award
...5star Mail Server is an extremely-reliable and fast SMTP/POP3 server. It...retrieved using any email client software that supports SMTP and POP3 protocols. The server has a built-in...email message sent only once. The 5star Mail Server provides enhanced security and anti-spam features....
 
popsmtpemail serverinternetprovider
...IGetMail adds on to your local SMTP-compliant e-mail server to automate the downloading of e-mail from multiple...Mail Server, or a UNIX based local e-mail server running, AND you are using an Internet Service...domain. These messages are stored on your ISP`s server until you pull the messages down. IGetMail solves...regular modem and phone line. Now your e-mail server can complete its job and route your e-mail...
 
eturnsmtp serveraliasigetmailcheck emaildialtcpercgatewaypop3retrievepopbeamerfetchpull mailexchange serverexchange connectorredirectpostofficee-mailinternet mail
Free Vista Files award
...Internet Email is sent through SMTP servers. Normally, your Internet Service Provider runs an...SMTP server for you, but often you cannot use their...communications whithout the hassle of finding a correct SMTP server to connect to. - Your Internet Service...clients, or club members). - Your Internet Service Provider has unreliable service, mail servers are occasionaly down...to send email promtly.
 
send emailmail clientsmtp serverweb serverweb site
...and passwords, E-mail Account, Display Name, Incoming (POP3) Server Name, Incoming User Name, Incoming Server Password, Outgoing...(SMTP) Server Name, Outgoing User Name, Outgoing Server Password... This is the best way to recover...all Outlook Express (POP3, SMTP account passwords and news server passwords). ASAP OE...
 
recoverybackuppasswordloginoutlookservere-mailsettingspop3identityexpressaccount
Marketing Mail Master

Freeware by Sandor Kovacs
10 x 1184Kb downloads

...and connecting their PCs to different Internet Service Providers in different countries. Send newsletters and mass e-mails...with this e-mail tool. You needn`t be an smtp provider (or your internet provider is VODAFONE -...no smtp server). It contains a built-in, a simplest, easy...to use SMTP mail relay serv er. It is used for...directly to destinations. - Remote access, use the server to send email from anywhere . - Minimizes...
 
bulkmassrecipientdirect mailmail relay serverremailersmtp provider serveranonymous emails
...* Directly. Just select this option in the SMTP window to send mail directly without specifying any...SMTP server and Vodamail 10 will do the rest for...list and port number. * Using third party SMTP Server. Specify any SMTP server along with any...and send mail. Rapid Email Sender supports any SMTP server along with free mail provider (Yahoo, Gmail,...dynamic message to each separate recipient.
 
smtp email senderbulk emaile-mailmailerunlimited email sendermailingbulk mailmass mailermarketingbulk maileremail softwareemail clientgroupmail
...It helps anyone to make proper use of SMTP server and maintain a large list neat and...is to make the best use of valuable SMTP resources. So, you will send all valid mails...Goggle account active for more days. As mail server will disable your mail if you send too...and save money. Same is applied for paid SMTP server. So, why waste money? Valid Email Verifier...connects via HTTP web server using a different port rather than port 25....
 
validate emailemail verifiercheck emailverify emailvalid email verifier
...Diafaan SMS Server is a powerful and easy to use SMS...Another option is to use an online SMS provider that supports the SMPP protocol or the Clickatell...You can setup an email interface that supports SMTP and POP and offers excellent integration with Microsoft...scripting capabilities. The full edition of Diafaan SMS Server has no limits on the number of GSM...
 
pagingpagerhttpclickatellsnppsmswctpsqlsmpptapmodemvisual basicemailgsmucp
...Diafaan SMS Server is a powerful and easy to use SMS...Another option is to use an online SMS provider that supports the SMPP protocol or the Clickatell...You can setup an email interface that supports SMTP and POP and offers excellent integration with Microsoft...scripting capabilities. The basic edition of Diafaan SMS Server supports up to four GSM modems, SMPP accounts...
 
wctphttpsqlsmppucpmodemgsmtappageremailclickatellsmssnpppagingvisual basic
...* Directly. Just select this option in the SMTP window to send mail directly without specifying any...SMTP server and Rapid Email Sender will do the rest...for you. * Using third party SMTP Server. Specify any SMTP server along with any...and send mail. Rapid Email Sender supports any SMTP server along with free mail provider (Yahoo, Gmail,...dynamic message to each separate recipient.
 
send unlimited emailsend mail directlyrapid email sendermailerbulk mail senderdirect mailer
...our unique and powerful web-based mailer any external SMTP or free email provider SMTP Servers.SMTPSWITCHMAILER can switch...each SMTP server automatically after sending the allowed maximum outgoing emails....
 
email marketing softwarephp mailersmtp rotate mailersmtp switch mailerweb based mailersmtp maileremail marketerbulk mailersmtpswitchmailerbulkmailerbulk emailweb mailerbulk email software