1 2 3 4 5 6

Sort by : ReleasedNameDownloadsAddedRatingRelevance

Freeware by ComponentSpot
18 x 862Kb downloads

...SMTPClient from Bossware lets developers add outgoing email capabilities to their Windows Forms and ASP.NET (Web...Forms) email apps using the SMTP protocol. The component does not use the .NET...several RFC (Request for Comment) documents concerning the SMTP protocol. However, it lacks logging and mail merge...
 
smtppop3assemblyemailimap4aspnetvbnet
.Net VisualPaseo Freeware

Freeware by Paseosoft
11 x 31445Kb downloads

...(ie. 35 free .Net components). Them run and control these middlewares in VisualStudio via Paseo SDK !...
 
recovery modeexportutilitiesdotnettelnetxmlapifile managementimportcomponentpingsmtpschedulersqlprocess managementftpdevelopmentdllprogramscriptpopimplicit variablestoolbatchrexecsdklog
Add Email ActiveX Professional

Demo by Traysoft Inc.
17 x 2435Kb downloads

Free Vista Files award
...Easily create and send text or HTML emails with attachments and embedded images from your application....C#, ASP, ASP.NET, Access, Delphi, PowerBuilder, FoxPro etc. AddEmail supports SMTP and ESMTP protocols with optional authentication...and much more. Enterprise version includes high-perfomance multithreaded SMTP engine that can queue and send emails directly...
 
activexcontrolbasicvbnetdelphibuilderaspe-mailsmtpocxaspnetvisualpowerbuilderemailcomponent
Add Email ActiveX Enterprise

Demo by Traysoft Inc.
13 x 2435Kb downloads

Free Vista Files award
...Easily create and send text or HTML emails with attachments and embedded images from your application....C#, ASP, ASP.NET, Access, Delphi, PowerBuilder, FoxPro etc. AddEmail supports SMTP and ESMTP protocols with optional authentication...and much more. Enterprise version includes high-perfomance multithreaded SMTP engine that can queue and send emails directly...
 
activexvisualvbnetcomponente-mailocxdelphismtpaspnetcontrolbuilderbasicpowerbuilderemail
GroupWare

Demo by Alt-N Technologies, Ltd.
10 x 1946Kb downloads

...include user configurable permissions where GroupWare users has control over the permissions of which folder(s) they wish...to share with other users, WorldClient (MDaemon`s web-based email client) will allow you to see items in...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
Free Vista Files award
...print to ANY printer installed on the Windows Control Panel, including USB, GDI, Windows-only and Virtual printers...using your own e-mail client program or an SMTP server, with or without user intervention - use...
 
networkpreviewunixoemlpt3mfcgdilpt1wmfcapturewindowsencryptionprintlpt2logofaxdosemfpdfdos2usbansidosprncodepagebmpprinterslinuxprograme-mailall-in-oneprn2filebarcodespassword
Out Spam

Shareware by Brigsoft
14 x 553Kb downloads

...user`s control. In the interactive mode a user controls the process of checking and removing letters. The...
 
anti-spammultilevellockerutilitiesutilitysmtpspam filteradvertisementsabuseantispamjunk mailtrustedinternetletterssenderbulke-mailtoolsclientaddspop3
MailTalkX

Shareware by SoftByte Labs
10 x 3760Kb downloads

...MailTalkX is a spam filtering (Anti-Spam) and an email monitoring utility, it supports multiple mailboxes, allows you...of message headers. With MailTalkX filtering you can control spam, personalize the audio/visual notification of new mail...
 
spamcontrolcheckblockerjunksmtpmailboxreferrerlogfilteringnotificationmailxmessageforwardingmonitoringsoundmultiplemailtalkxemailunwanted
NetWatcher

Shareware by Toleron Software
22 x 802Kb downloads

...interested in the accurate and up-to-date network state control will appreciate the merits of this software solution....
 
sessionsmtpserviceicmpnetwatcherftppop3networkcharttcpipstabilityping
PageGate

Shareware by NotePage, Inc.
18 x 12459Kb downloads

Free Vista Files award
...gateway is a flexible powerful way to take control of corporate communications. PageGate supports several delivery protocols...Internet using the following protocols: SNPP, WCTP, and SMTP (email). Messages can be delivered via modem using...
 
sms messagingemail pagingcell phonewireless messaginggsmtextsnppfaxpaging softwareinternet pagingmobilewctpsmtpsend smsmobile phonesms pagertext message
...artificial intelligence with self-learning filter processes. A special SMTP gateway verifies the identity of the sending instance...virus infection. A special interface to Norman Virus Control offers a proactive solution to protect the system...in a multi threaded environment. This guarantees unrestricted email transfer, even if the system is busy with...message processing is server side based and thus controlled at a centralized level. This protects the rest...
 
smtpbayespop3spamvirusemailfirewallsecurityfilter
...be able to send E-mail by accessing an SMTP server with minimal knowledge of how SMTP works...for simplifying tasks of accessing and utilizing an SMTP server and sending e- mail. The control talks...directly with the SMTP servers and completely bypasses MAPI and any of...that MAPI has.(i.e. Security dialogs and other nuisances) SMTP Wizard +SSL v3 allows you to: Be used...
 
exampleshypertextfree downloadfile controlsmtp ocxsource codeprotocolsmtp activex
...can communicate using SSL or normal clear-text. The control is designed in such a way that it...Any data connection to web servers, ftp server, smtp or any other server using the TCP protocol...endless and the ROI is signficant since the control is ROYALTY-FREE and may used in any number...long as each developer has a license. This control works with any ActiveX container and even works...
 
ssl socket activexprotocolfree downloadfile controlsource codehypertextexamplesssl socket ocx
...DNS MX Wizard is an ActiveX control that lets you query a Domain Name System...server to try and communicate with first. This control has many uses, here are some: You can...write your own SMTP Server and use this to lookup where to...deliver the mail. Verify email addresses by looking up the domains MX record...and verifying the email address with the mail server for the domain....records are correct and haven`t been "hacked".
 
domainexchangeemailsystemrecordsdnsserver
Free Vista Files award
...MarshallSoft SMTP/POP3/IMAP COBOL email component library (SEE4CB) uses a simple API to...an application. Features of SEE4CB include: - Send email with inline HTML, GIF, TIF, JPG, BMP and...character coding. - Supports CHARSET_WIN_1250. - Support for email servers that require SSL (gmail,yahoo,hotmail, etc.). - Get...the number of messages on your email server. - Get the header lines from any...without reading the entire email.
 
pop3 cobolhtmlpop3 componentmimemicro focus emailutf-8html emailcobol pop3cobol componentimapsmtp cobolsend mail cobolsmtp componentbase64email cobolfujitsu cobol emailnet smtpsend emailiso-8859esmtppop3 authentication
Free Vista Files award
...MarshallSoft SMTP/POP3/IMAP dBASE email component library (SEE4DB) uses a simple API to...an application. Features of SEE4DB include: - Send email with inline HTML, GIF, TIF, JPG, BMP and...- Get the number of messages on your email server. - Get the header lines from any...without reading the entire email. - Delete any email on the server without downloading the entire email....- Copy any email on the server without deleting it.
 
email softwarehtml emailmail ssltlsutf-8email componentpop3 dbaseemail dbasenet emailimapestmpsend emailsmtp libraryssl mailpop3 componentbulk mailiso-8859smtp dbaseauthentication mailsmtp component
Free Vista Files award
...MarshallSoft SMTP/POP3/IMAP Xbase++ email component library (SEE4XB) uses a simple API to...an application. Features of SEE4XB include: - Send email with inline HTML, GIF, TIF, JPG, BMP and...Supports CHARSET_WIN_1250, CHARSET_WIN_1252 and CHARSET_WIN_1255. - Support for email servers that require SSL (gmail,yahoo,hotmail, etc.). - Get...the number of messages on your email server. - Get the header lines from any...without reading the entire email.
 
pop3 componentxbase emailmimeemail libraryxbase smtpsmtp componentsmtp gmailbase64email componentimapssl emailesmtpiso-8859html emailsend emailpop3 authenticationutf-8xbase pop3
Free Vista Files award
...MarshallSoft SMTP/POP3/IMAP Visual FoxPro email component library (SEE4FP) uses a simple API to...an application. Features of SEE4FP include: - Send email with inline HTML, GIF, TIF, JPG, BMP and...- Get the number of messages on your email server. - Get the header lines from any...without reading the entire email. - Delete any email on the server without downloading the entire email....
 
html emailsend emailpop3email componentxbasepop3 componentiso-8859base64email foxprosmtpfoxpro emailutf-8smtp componentpop3 authenticationmimefoxpro pop3ssl emailsmtp gmailfoxpro smtpimapesmtpemail library
...MarshallSoft SMTP/POP3/IMAP Delphi email component library (SEE4D) uses a simple API to...an application. Features of SEE4D include: - Send email with inline HTML, GIF, TIF, JPG, BMP and...character coding. - Supports CHARSET_WIN_1250. - Support for email servers that require SSL (gmail,yahoo,hotmail, etc.). - Get...the number of messages on your email server. - Get the header lines from any...without reading the entire email.
 
pop3 componentsmtpiso-8859smtp delphiemail ssltlsemail componentssl mailsmtp componentimapemail softwareauthentication mailpop3 delphiutf-8html emaildelphi xe2net emailemail delphismtp librarysend emailmimeestmp
Free Vista Files award
...MarshallSoft SMTP/POP3/IMAP Visual Basic email (32 & 64 bit) component library (SEE4VB) uses...an application. Features of SEE4VB include: - Send email with inline HTML, GIF, TIF, JPG, BMP and...character coding. - Supports CHARSET_WIN_1250. - Support for email servers that require SSL/TLS. - Get the number...of messages on your email server. - Get the header lines from any...without reading the entire email.
 
pop3mail componentsend emailsmtpmimeemail componentutf-8iso-8859ssl mailestmppop3 componentemail softwarenet emailmail ssltlsemail visual basicsmtp libraryhtml emailimapauthentication mailsmtp component