Sort by : ReleasedNameDownloadsAddedRatingRelevance
Net Blitz

Freeware by Emparch
162 x 1312Kb downloads

...the best program to play Chess or Bughouse over the Internet or local network. Net Blitz II...
 
networkfreedoublechessonlinegamemultiplayerbughouse
I of the Enemy: Ril`Cerat

Freeware by Enemy Technology
361 x 68891Kb downloads

...achieve favorable match-ups, rather than just waiting for overwhelming numerical superiority....
 
the enemyreal time strategysingle-playervideo gamesenemy technologymulti-playerlaninternetsci-fi
Internet Broadcasting Server - Free Ed.

Freeware by Broadcasting-Software
453 x 1719Kb downloads

Free Vista Files award
...Broadcast live audio, MP3 music and photos over the Internet ! The Internet Broadcasting Server is...amplifier. All you need to start your own Internet broadcast is this program, and the ability to...and music, BS-Tuner has no "Save" feature. With Internet Broadcasting Server, you can easily set up a...
 
slideshowbroadcastinternetwebcastmultimediaserverweb-radiostreamingbroadcasting
Advanced Security Tool - AST

Freeware by PatilanSoft
134 x 4000Kb downloads

...are encrypted. Auto fill login and passwords in Internet Explorer. BOOKMARKS MANAGER: Import Favorites from Internet Explorer,Mozilla...prevent your passwords from theft. Integrated into Microsoft Internet Explorer. XP interface....
 
explorerciphersecretkeyloggerfillloginsmanagerpadgeneratorinternetpasswordbookmarksnote-bookautoencrypted
Mp3search

Freeware by Mp3 software
350 x 292Kb downloads

...the best MP3 search engines available on the Internet today. It not only finds the music you...
 
mp3 searchmp3 songsmp3 filesfree mp3 musicmp3 softwarefree mp3 download
Scannet Pro

Shareware by Profiler3d
295 x 11118Kb downloads

...max. HOPS and Timeouts.The system-scan gives you an overlook over the actual storage capacity of GDI, user...or network.The WHOIS module allows redetecting of connections over a number of individual WHOIS servers including the...
 
system informationnetzwerk-ressource-explorertraffic monitornetwork toolshard and software inventorynetwork monitoradmin tool
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...services. The included LDAPv3 server also supports LDAP over SSL (LDAPS). Support for standard public key encryption...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
AntiSpye

Freeware by ZERGE.COM
121 x 384Kb downloads

...corners and that is! Your screen will be covered by blank window, screensaver or even by one...FEATURES * Three types of action: blank screen, cover image, screensaver * Built-in screenshot taking tracker *...
 
screenshot takerantispyesoftwarehidefreewaremouseblank screen
Konst Pinger

Freeware by VisualSoft
213 x 1015Kb downloads

...Pinger is a program for ping and trace internet host. Ping host that you choice. Show results...
 
internettracepingwhoishost
Paessler URL Recorder

Freeware by Paessler AG
92 x 740Kb downloads

...Paessler URL Recorder helps to find out the URLs and POSTDATA strings that a user sends to a web server while surfing a sequence of URLs. It works like a...
 
urlbrowser toolanalysispaessler site inspectorweb authoringrecorderinternet explorerextensionswebpagehtml
Free Download Manager

Freeware by FreeDownloadManager.ORG
1049 x 7039Kb downloads

Free Vista Files award
...application that has millions of loyal users all over the world. It lets you download files or...
 
free download managerresume broken downloadsaccelerate downloadsdownloaderimprove download speeddownload acceleratorsplit downloadspeed downloadsdownload boosterincrease download speeddownload web site
Mach5 Mailer

Freeware by Mach5 Development
114 x 9854Kb downloads

Free Vista Files award
...any database that supports this common standard. Even over the internet or across your LAN. Note. Mailer...
 
sqle-mailphpmergeattachmentsinfactajavascriptmicrosoftcsvbulkvisualwindowsnewslettermailingsodbcopt-inlisthtmlnotificationworldmailvistaexcelsoftwaremassemailerdatabasecustomizemarketingaccess
FastStats Analyzer Free

Freeware by Mach5 Development
91 x 2851Kb downloads

Free Vista Files award
...traffic from page to page through your website. Discover how your visitors really move through your pages!...
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
XSite

Freeware by Veign
82 x 1705Kb downloads

...XSite will load and parse any webpage into a simple structured view for displaying images, email addresses, and all links. Generate a result report that section out all the links,...
 
extractemail addressesinternetwebpageimages
...page loading time by blocking the most annoying Internet ads. VAB can block advertisement in the forms...installed on your computer while you surf the Internet from advertisement ads. VAB blocks video and flashing...
 
interactive videofull-screen with video adsvideo pop-up stoperstop flashvideo pop blockthe video commercialflash animation stoppervideo pop killervideo popup blockstop video popupblock flashvideo popup stopper
Car Logbook

Freeware by Z5Com Pty Ltd
90 x 78Kb downloads

...Car Logbook is an applet designed to track the business use of vehicles. It supports multiple vehicles and...
 
car usagevehicle usagevatcar logbookvehicle mileagetaxvehicle kilometersvehicle logbookcar kilometerscar mileagecar travelato
Job Seek Manager

Freeware by Z5Com Pty Ltd
97 x 65Kb downloads

...Job Seek Manager was designed to help you manage jobs applications. The process is very simple you select a job from the Web and copy and paste data into this...
 
apply job softwareapply work softwareapply contract softwareseek job softwarefind job softwareseek contract softwarefind contract softwarejob application softwarejob search software
...(send mail), NNTP (newsgroups)! It works great with Internet Explorer, Firefox, Outlook, and many more!...
 
proxylogtunnel
...X-Ray is an email header filter and POP/SMTP server switching tool. It runs as a local POP/SMTP relay server and scans your incoming and/or outgoing mail...
 
internetutilitiesmail headermail headers

Freeware by Carson E. White
148 x 26119Kb downloads

...Grids that are all printable. And a free internet version family tree builder at www.winloft.com. Includes conversions...
 
genealogytreedatabasesoftwarefamily