1 2 3 4 5

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Picture Viewer .EXE

Shareware by SoftTech InterCorp
63 x 2377Kb downloads

...cameras, photo galleries or scanners. Create and run slideshow presentations, browse folders and directories, build dynamic playlists,...uncomplicated image viewing, PictureViewer .EXE provides a comprehensive slideshow utility supporting auto-play, custom time intervals, forward, reverse...play orders. With fullscreen navigation controls displaying fullscreen slideshows is easy as a single mouse-click, making PictureViewer...PictureViewer .
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
Picture Studio .EXE Professional

Freeware by SoftTech InterCorp
53 x 3076Kb downloads

...hundreds of digital photos or looking to create slideshow presentations, PictureViewer .EXE makes the process simple. Then,...Studio .EXE Professional provides you with the necessary tools to indulge yourself through your own digital art...
 
gifbmpplaylistpicturedisplaywallpapergraphicsjpgslideshowphotoimageviewertif
Wallpaper Slideshow LT

Freeware by gPhotoShow.com
153 x 2064Kb downloads

Free Vista Files award
...Wallpaper Slideshow is a great utility for displaying your favorite...photos as desktop wallpaper. Wallpaper Slideshow offers you complete control on your wallpapers collection...GIF, PNG, TIFF, BMP) as desktop wallpaper. Wallpaper Slideshow is simple to use, intuitive and complete with...
 
photowallpaperimagewallpaper toolsslidepicturesimagesdigital camerashowslideshowdesktop enhancementfreewallpaper changerphotos
Corel Snapfire Plus

Shareware by Corel Corporation
97 x 125094Kb downloads

Free Vista Files award
...work with digital photos.Enhance: From easy-to-use professional-level retouching tools to one-click quick fixes, Snapfire Plus will make...
 
slideshowdigital photographyvideoshareenhanceprotectorganize
jAlbum

Commercial by JAlbum AB
137 x 10650Kb downloads

Free Vista Files award
...on jalbum.net. - Add widgets Widgets are fun tools that add functionality to your jAlbum such as...
 
web slideshowweb photo albumphoto gallerythumbnail generatorimage editingweb photo indexjava slideshowjava web album generator
Multi Screen Emulator for Windows

Shareware by SiComponents
45 x 1622Kb downloads

Free Vista Files award
...tools, such as text editors, spreadsheets and engineering tools on one screen; use the second one for...games and a third one to launch a slideshow or CD-player with pleasant music. The possibilities are...
 
virtual desktopsmultiple screensextra desktopmultiple desktops
Sothink Glanda

Shareware by SourceTec Software
25 x 26290Kb downloads

Free Vista Files award
...it into your own Flash arts. Various drawing tools are provided for you to draw and edit...
 
album creatorflash animation softwarebuttons creatorbanners creatorflash buttonscool text effectslideshowflash albums makerflash bannerstext animation
Active Suite

Shareware by Actives Softwares
55 x 28362Kb downloads

...fix an uneven horizon,...), or use the powerful tools for advanced retouching features. With Active Studio, apply...complicated effects without complication ! - Active SlideShow wizard to make a multimedia slide show project,...
 
slidechangercalendarimageretouchautomaticwallpaperbackgroundsharewaredesktopdailyphotopictureshownotealarme
Cresotech PocketPoint

Shareware by Cresotech, Inc.
24 x 1134Kb downloads

...CRESOTECH POCKETPOINT is an easy PDA based multimedia tool to create photo presentations or review photo albums simply and quickly. You don`t need any special skills or experience to...
 
presentationmultimediatoolsslidepocketpointwipessharewarecresotechphotoslideshowimagesoftwarebusinessviewgraphicsfreewarepicturealbumtransitionskinnableutilitiesprogram
Free Vista Files award
...once offers even more options, such as creating slideshows and webpages with one click and an tool...
 
menuimagecontextcropredeyefilterpluginconverteffectwebpagerotateutilityremover
Rotor 3D Viewer

Shareware by Seyna Ltd.
33 x 1561Kb downloads

...Rotor 3D Viewer is a viewer, which quickly generates a high-quality display of your 3d models. It is one of the best easy and convenient ways of creating 3D...
 
viewingformatsoftware3dsrotor3dobjectmaxdisplayplayerbusinesspresentationmodelshowanimationexport meshespolygonviewerscomputerfileshigh
Axialis Screensaver Producer

Shareware by Axialis Software
29 x 32982Kb downloads

...all kind of screensavers based on Sprites, Flash, Slideshows and Video Clips. It has a fully integrated...can be included in the install package). Creating slideshow screensavers is also possible. Many transitions are available...
 
librarianscreen saver makerimagevideoflashdistributionspritecompilerviewerwysiwyg editor
ACDSee 9 Photo Manager

Shareware by ACD Systems
57 x 27488Kb downloads

...options, slide shows, CD/DVD burning, and web album tools that make sharing your photos as easy as...
 
image viewerimage managementpicture viewerdigital photo softwareslide showmultimediaprinting softwarecontact sheetsdigital cameradata managementphoto editorscreensaverphoto albumscreen captureslideshowdigital imaging
ACD FotoAngelo

Shareware by ACD Systems
63 x 3484Kb downloads

...you add sound, text and transition effects. Simple tools like the image ordering drag-and-drop storyboard area, make...
 
digital photo album softwarescreen saver makerslideshow softwareslideshow programsslide show softwaremultimedia builderscreensaver softwaremake your own screensaverphoto softwareslide show maker
...making your Screen Saver more interesting than simple slideshow type effects. Easy to use Wizards help you...
 
toolkittoolsscreensaver
SlideShow

Demo by CAD-KAS GbR
30 x 810Kb downloads

...Do you want to create professional slideshows and presentations? Simply add your pictures and videos...sound effect and comment. You can export the slideshow as Video file. With special tools you can...
 
picturesslideshowdvdeffectsexportthumbnailmpegcad-kaspresentationphotosburnvideoplayer
webcamAMP

Shareware by KV Designs
66 x 5385Kb downloads

...webcam or not, webcamAMP provides a large variety tools to effectively communicate through all your favorite webcam...
 
ispqsplitcamnetmeetingmeetcamvideoconferenceicuiicamtracksuperwebcamcamfrogfunwebcamsoftcamvirtualcamerafake camwebcamsplitterdriverdigitalpeersanywebcamjmeeting
CyPics - Photo Cataloging

Shareware by CyWarp
35 x 18904Kb downloads

...your growing digital photo collection. Create high quality slideshows in minutes utilizing timelines or for complete control...sequence the images with titles and subtitles. Slideshow facilities include: panning panoramas; starting from any photo;...saved to create a permanent image group for slideshows and printing. Future photos of people or topics...text. Photo sharing options include emailing photos and slideshow export to HDTV, iPad, iPhone, Apple TV &...
 
pictureexifslideshowsoftwareiptccataloguingalbummanagementdatabasecypics photo catalogingdvdimagedigitalcameraphotographorganizerphotographyelectronicasset
...Center. Replace your Wallpaper with a Calendar, Websearch Tools or Browsers. Admire a stunning Earth Simulation, thousands...of Webcams, Slideshows or unique combinations of all of this. Integrate...you of dates or appointments. Have online search tools always available. Display a webbrowser that can shuffle...
 
globeslideshowbackgroundnighttoolwebcamsbrowserscreensaverwallpaperwebsearchwebcameracalendaranimateddesktopearth simulationonline
VideoConstructor

Shareware by Protectedsoft Ltd.
17 x 3809Kb downloads

...thousands of dollars. Small software companies release simplified tools that cover some of the most popular video...editing and processing features. Such tools typically cost $15-$20 and you can use them...extract certain parts of a video file. The Slideshow maker module is intended to create sideshows from...
 
convertervideo