1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23

Sort by : ReleasedNameDownloadsAddedRatingRelevance
FastStats Analyzer Free

Freeware by Mach5 Development
91 x 2851Kb downloads

Free Vista Files award
...Super-fast site log file analysis with SmartDNS lookup. Choose from...FREE license, Regular, or Gold. Mach5 Analyzer makes websites work for businesses with the fastest log analysis...to process -- Mach5 Analyzer makes crunching your website data a waltz in the park. Includes Hits,...Bandwidth, Search Keywords and Phrases, Referrers, Visitors per day, Most...printing.
 
analogfaststatsanalysislinkanalyticswwwstatswebsitetraffichitlistmetricshit counteranalyzeriiserrorinternetstatisticsapachereferrerwebtrendswebserver
Webmasters Tool

Freeware by MicraCom
107 x 6579Kb downloads

...submission campaign controlled entirely by you not the software The webmasters tool will only pre-populate web pages...submit keeping you in control. Comprehensives list of sites to post to including over 160 RSS, PAD,...MSN, Yahoo and Google for the amount of site targeting a keyword and return a ranking based...upon a percentage of searches estimated by Overtures keyword suggestion tool. Automation The...
 
promotionweb rankingsfree softwaremeta tag toolpad submissionssearch engine marketing
GooPR

Freeware by TM Services
61 x 0Kb downloads

...will get the Google pagerank value and web site position in Google directory. It`s very convenient to...of Delphi you may order this through Plimus software registration service....
 
relevancepositiongoogle directorysearch engineseooptimizationanalyzepagerank
CiDess

Freeware by CiDess
96 x 3158Kb downloads

...as 3DG file - Featured file manager with search engine, find and sort easily your PCB files...change language during program execution - A free software is available to translate CiDess in any language,...description in the coders section of this web site - 100% free - Can run on a...
 
layouteditorpcbfree
CoffeeCup Free HTML Editor

Freeware by CoffeeCup Software
257 x 28570Kb downloads

Free Vista Files award
...want to create great websites, totally stellar, kick-butt websites that leave people saying, "Wow, you really made...new best friend. HTML veterans, you`ll create standards-compliant sites using powerful tools like code completion and built-in...resources like the comprehensive tag reference and vibrant website themes. And for those of you who like...everyone - not too shabby, eh? With valid website code, your pages display consistently in different...
 
appletssharewarewebsite designweb sitesoftwareflashhtmlimage mapeditorjavagif animatorhtml editorjavascriptwysiwygfreeftpfreewarexml
Alien IP

Shareware by ArmCode
89 x 16931Kb downloads

...Alien IP is trace routing software that resolves domain names, pings IP addresses, and...information about remote domains, email senders and web site visitors. Alien IP has a clear and straightforward...world of today with the large number of site visitors daily, it is sometimes difficult to track...
 
searchwebgeolookuphostpositionaddressresolve
AlterWind Log Analyzer Lite

Freeware by AlterWind Software
66 x 2271Kb downloads

...quickly generates all traditional reports. Use this user-friendly software to grab web server logs (all formats supported)...and build graphically-rich self-explanatory reports on web site usage statistics, referring sites, traffic flow, search phrases...much more! AlterWind Log Analyzer Lite supports 430+ search engines from 120 different countries. Reports generated by...
 
alterwindsample reportwebsite statisticsloganalyzerconfiguration stringserver logssite mirrorslog analyzerapachelog analysislog files any format
Audio Video IFilter

Freeware by AimingTech Company
75 x 325Kb downloads

...with all indexing services based on the Microsoft Search technology: Microsoft Indexing Service, Windows Desktop Search, Microsoft...index the WMA, WMV, MP3 files providing content search for them. Audio Video IFilter extracts two kinds...the MP3 files. Audio Video IFilter is a software component that provides benefits together with other Windows...applications. With AimAtFile Fast File Search the IFilter helps you quickly find music and...
 
ifiltersearchindexingsharepointmp3desktopwmaservicewmv
LinkSpirit

Freeware by Zapman
52 x 887Kb downloads

...decide of their positions in the results of search engines. It is calculated according to the number...chance to appear in the results of the search engines - Privilege a page with the prejudice...
 
pageranklinkanalyserinternal
BackLinks Master

Freeware by CleverStat
60 x 1392Kb downloads

...very effective way to increase your rank in search engines. No matter how you got inbound links...to your site (submitted your site to DMOZ, participated in reciprocal linking programs, or...URLs, submit your target keywords to see linking sites with these keywords in anchor text and so...
 
reciprocal linksbacklinks softwareback link
CB Bar

Freeware by Clickbank Ebook
59 x 1045Kb downloads

...Clickbank sells some of the hottest and newest software available on the Internet today. If you are...it is a little hard to find the software that you are looking for in the Clickbank...Marketplace. There is not a simple way to search it. Until the CB Bar. Search the Clickbank...spyware or adware associated with many other toolbars. Search Clickbank in depth. Get the CB Bar...
 
search engineebookssoftwareclickbankaffiliatemarketingtoolbar
Lucky Downloads search

Freeware by Lucky Downloads
66 x 468Kb downloads

...Lucky Downloads search is a free utitity that enables you to...click the icon. After that you enter a search query and get results from Lucky Downloads web...
 
freewaresoftwaresharewaredownloadsfind similarluckytoolsearch
JPEG IFilter

Freeware by AimingTech Company
78 x 1137Kb downloads

...compatible with indexing services based on the Microsoft Search technology: Microsoft Indexing Service, Windows Desktop Search, Microsoft...files (extensions JPG, JPEG, JPE, JFIF) providing content search for them. JPEG IFilter is a software component...with other Windows applications. With AimAtFile Fast File Search the IFilter helps you quickly find photos in...
 
sharepointfindsearchjpgimagejpegifilterserviceindexing
InfoGoGetter

Freeware by Pairowoodies
49 x 397Kb downloads

...InfoGoGetter is a free (as in beer) software program designed for InfoGoRound.com members. It simplifies the...to build up the content of a new site quickly. Just enter your new site`s primary keyword,...then double click the articles in the search results you want to publish. A new window...
 
articleshtmlinfogoroundextractionconversion
QuidProQuo

Freeware by TJ Enterprises LLC
67 x 23068Kb downloads

...QuidProQuo automatically scans through your site to locate your link partners. It then spiders...through your link partners sites to verify reciprocal links back to you. It...to speed up the process by spidering multiple sites at the same time (the lite version has...a maximum of 2 threads). The software checks links through the Yahoo search engine first...
 
quidproquoverificationreciprocal link checkerreciprocal linkinglink exchange softwarecheckingconfirmation
Bazooka Adware and Spyware Scanner

Freeware by Kephyr
133 x 750Kb downloads

...and trackware components; sources of irritation that antivirus software does not deal with. The scanning process will...and tell you how to uninstall the unwanted software using simple step-by-step instructions or put you in...instructions. Spyware and adware is often bundled with software such as Kazaa, Morpheus, Grokster, Imesh, Xolox, Gnutella...fit your preferences. Bazooka Adware and Spyware Scanner search for more than 500 unwanted softwares, such as..
 
privacygroksterdetectwindowsfoistwaresecuritytrojansbazookaspywarebrowserthiefwareeliminateremovegatorkephyradwarefreewareparasiteregistryscanneradawarescumwareadvertising
FtpRight

Freeware by FtpRight.net
51 x 5475Kb downloads

...for Windows that lets you update a Web site with a single mouse click and resume interrupted...Manager comes preloaded with lots of popular FTP sites and adding your own FTP sites is easy....Note: This software works similar to CuteFtp, WSFTP Pro and FTP...
 
freeftpsoftwarereceivefreewareftprightfreeftpprogramcommandexplorerbulletproofvoyagerftpclientfilesecureanonymousbrowsersmartsendprotocoldreamcastpublictransferexpertsharewareleechresumeleapsearch
Software Promotion Toolkit

Freeware by Software Submit.NET
18 x 2392Kb downloads

...The Software Promotion Toolkit is the ultimate solution for your...It will show you how to expand your software presence on the interent download sites, search engines...downloads of your application, more traffic to your site and more sales. Avaliable tools: Software promotion category...file creation » PAD file validation » FREE software submission to 20 download sites Website promotion category...
 
software marketingshareware distributionsoftware submitsearch engines submissionsoftware submissionsoftware distributionshareware promotionsubmission serviceshareware marketingsoftware promotion
Jvw Google rank and pagerank finder

Freeware by Jimmy`s Value World
29 x 350Kb downloads

...A free search engine optimization software by Jvw at google-ranking.info. Jvw Google rank/Pagerank finder...software - Notifies your Site ranking, Pagerank and more... This software is easy-to-use...factors that determines a page`s ranking on the search results. Jvw rank/PageRank Finder helps you find valuable...Find more info on Google Pagerank on google site at www.google.com/technology/ You can also keep a check...
 
searchfreesoftwareengineoptimization
XTerm Medical Dictionary

Freeware by kpiachem
59 x 3900Kb downloads

...handy, easy to use application that includes a search engine with wildcard and incorrect spelling searches. The...terms is updated weekly on the publisher’s Web site and the software features a function to easily...
 
glossarysymptomsmedical informationsmedical termskpiachemmedical dictionarymedical terminologyfreewarediseasesacronymsxtermabbreviations