1 2 3 4 5 6 7 8 9 ... 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29

Sort by : ReleasedNameDownloadsAddedRatingRelevance
...Software is powerful, interactive & easy-to-use pen drive data recovery tool which made data recovery on pen...drive process easily for users. Recover Data for Pen Drive file recovery tool is cost...the attractive GUI (Graphical User Interface) which makes data recovery on pen drive in few simple clicks....usb deleted files in following conditions: 1) USB Data Recovery tool to recover pen drive data from...keys.
 
pen drive softwarepen drive file recoveryusb recovery toolpen drive recovery toolrecover usb deleted filesrecover pen drive filesrestore pen drive filesrecover pen drive datapen drive data recoveryusb file recovery toolusb data recovery
PacketsDump

Freeware by Ax3soft
7 x 3327Kb downloads

...Features * Packet Capture and Playback Packetsdump can show the snapshot of data in LAN and save...these data to as a trace file for analysis later....received. Packetsdump lets you to know all the data transmitted through your network. Let you follow the...
 
protocol analyzernetwork snifferpacket sniffer
Security Shield 2011

Shareware by PCSecurityShield
6 x 245353Kb downloads

...of technologies that protect against identity theft, confidential data leakage and all Internet threats. Add privacy and...unique technologies that protect against identity theft, confidential data leakage and all Internet threats. Automated Hourly Anti-Malware...Updates Independent tests show Kaspersky is #1 for detecting viruses and spyware....runs all files that don`t match our signature database in a safe, isolated section to check for...
 
identity theftphishing protectionanti-hackerfirewall protectionantivirus softwaresecurity softwarespyware protectioninternet security
...the - and + signs. The program will show you all possible textual variants of the specified...
 
memorizernumbersrememberphonememory improvementmemorisermnemonic
...bitmap fonts from a PCL file. PCLCodes can show a ASCII character representation of raster data in...• Displays and ASCII character representation of raster data objects in the PCL. • Generats font metric...
 
learn pclpcl toolpcl editpcl utilpcl codepclcodesescape code
!Easy ScreenSaver Station

Shareware by DDSoft
4 x 2059Kb downloads

...* Acquire photos form digital camera/scanner directly; * Show your images or Flash movies as LOGO throughout...
 
flash screensavercreate screensaveredit screensavermake screensaverscreensaver softwarescreensaver builderscreensaver makerscreen saver
...web applications. Using FusionMaps, you can display geographical data distributed by category, regions or entities. Ideal usage...office locations, election results, survey results or business data like "Revenue by Regions" or "Revenue by states"....US states. The maps are driven by XML data source and can be integrated with any scripting...up a map and connecting it to your database takes only a few minutes and doesn`t involve...
 
europe mapsinteractive mapsbusiness mapsregional maps for websitemaps flashflash mapsstate maps
Virtual Image Organizer

Demo by SC Refero Group SRL
6 x 1972Kb downloads

...renaming and re-organizing function, based on image Exif data If you want TO rename and organize your...F-Number...) Software features: -Fast picture renaming based Exif data -Support of all Exif data( date picture taken,...Agent wich automatically detect new USB drives and show information from this by a balloon hint. -Easy...multiple directories including sub directories -Export of Exif data as xml -Integrated source folder details page with...
 
jpgjpegexifxmlthumbnailorganizesort
ProjectTrack SQL Server Edition

Shareware by iLore
4 x 29388Kb downloads

...START the day with ProjectTrack TODAY. It will show you of the status of your projects and...HTML or Text) * FILTER information, by creating data filters in plain English, so you can look...
 
resolutionportfolioprogramspreadsheetcustomerprojecttaskdocumentjournalmilestonecalendarganttinitiativeoutlookmanagementemailissueriskactiontrackingexcelplanningmanagercontactclientteam
RadarCube ASP.NET OLAP Chart for MSAS

Shareware by Radar-Soft, L.L.C.
7 x 28214Kb downloads

...add Visual Analysis to your applications. Displays business data on the internet in charts and graphs rather...Gives users an opportunity to analyze their business data visually and spot new trends and discover unknown...problems in their data flow. - RIA Advantages: With Rich Internet Applications...web as live as never. Overwhelming interactivity. - Data Source: Take your cube from MS Analysis Services...email.
 
analysisbusiness intelligenceolapolap cubeowcweb olapweb chartsilverlightria chartdrillingaspnetsilverlight charthierarchyolap chartweb visual analysis
BrowseReporter

Shareware by Codework
4 x 59765Kb downloads

...information can be sent silently to the central database server. In stealth mode, BrowseReporter does not show...stealth mode without the users’ knowledge. Web browsing data stored centrally on the administrator`s system. Try now...
 
reporting web browsinganalyze web usagemonitor user browsinginternet reporting tooltrack user surfinginternet abuse
SolarWinds Real-Time NetFlow Analyzer

Freeware by SolarWinds
3 x 21146Kb downloads

...the key... we`ve developed a free tool that shows you exactly what`s on your network. SolarWinds` newest...NetFlow, Real-time NetFlow Analyzer captures and analyzes this data in real time to show you exactly what...Even better, you can view the historical NetFlow data broken out by application, conversation, domain, endpoint, and...
 
sflownetflowtraffic analyzernetwork monitoringjflowsolarwindsnetflow traffic
Flash Map One

Demo by Flash Map
4 x 1708Kb downloads

...are editable using Adobe Flash 8.0/MX/CS (or above). Data can be retrieved and processed by any engine...change of interactive map settings or display dynamic data within flash maps Color code each area or...- Obtain extended information pertaining to each area. Show your locations. - Add your offices, points of...
 
map flashinteractive flash maps
Delete Duplicate Files Fast

Shareware by Ashisoft
7 x 1922Kb downloads

...you reclaim your valuable disk space and improve data efficiency Features + Two powerful search engines (byte...+ Skips the hidden files and folder. + Show file versions and properties. + Resizable popup picture...
 
delete duplicate filescheck identical filesbyte-by-byte comparisondupe hunterduplicate file finderduplicate finder
World Map in Flash

Shareware by USFlashMap.com
11 x 120Kb downloads

...to present any kind of business or personal data worldwide. It took web-mapping experience, intelligence and time...page or intranet interface! 2. Easy integration and data import. World Map in Flash is completely XML...manually, or use any scripting language to import data from your database or spreadsheet (Excel/CVS). 3. Fully-featured...- hide locations on the world view; - show / hide left panel (for small size); -...
 
flash mapdynamic world mapinteractive world mapclickable world mapworld map flash
Forex trade Calculator

Shareware by MiraSoftware
3 x 667Kb downloads

...inportant news in real time. Inportant news events showed by yellow labels on the alert panel (blue...be positive value, else - negative value. 4. Data in New row (Lot, Profit, Pps, Opening price)...will be calculated automatically. 5. To use New data as Current - press Y button on top...caption changes color to gray when waiting quotes data Another features: 1. News table - show economic...
 
forex trade calculatorquotestrade softwarestock marketloss calculatortrade calculating toolprofit calculatorcalculating softwareeconomic calendar
...the information about what is a hard disk, showing disk usage and folder structure by several pressing...first window is the bottom left one. It shows disk usage in the PC. Thanks to the...left one. A choice window. This window also shows disk usage but differently. This is a window...etc. The additional means of the analysis which shows disk usage are sorting and data filter. Besides,...
 
disk usage visualizationshow disk usagedisk space visualizationview disk usage
...the waveform window. Extract a track from CD. Show file properties. Play an audio file or any...
 
mp2audiooggmpcdvdmp3g723wavg726g721recordconverteditmpegtapescdarawvcdaiffvox
Mini SharePoint Calendar Web Part

Shareware by iTechArt Group
38 x 11878Kb downloads

...It is compact but packed with all necessary data and can fit anywhere on your page. It...the Mini SharePoint Calendar are ticked off to show that there is some event scheduled. The ticks...events just hover over a marked date: displays data from any SharePoint list or library, customizable size,...
 
sharepoint calendarorgonizer
ezBarcodeComponent

Shareware by BarcodeLabelPro
3 x 1206Kb downloads

...QRCode. It is very easy for ezBarcodeComponent to databind in application and used in Crystal Report, even...project for windows forms, crystal report, web services, data binding and asp.net.ezBarcodeComponent lets you rotate, save the...examples are also included in the download. 1) DataBinding Example ezBarcodeComponent allows to drag the data field...from data source and drop it to the ezBarcodeComponent control....
 
librarybarcodecomponent