1 2 3 4 5 6 7 8 9 ... 19 20 21 22 23 24 25 26 27 28

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SQLWriter

Shareware by ljcsoftdev
102 x 2012Kb downloads

Free Vista Files award
...is a powerful SQL script editor for all database developers and database administrators. It supports ACCESS, SQL...code completion. You can browse the SQL result data and objects of any database. You can create...or modify the database template to customize everything´╝ü So this SQL tool...you work more efficiently. It has many features. Database template: add/remove database object which showed in database...
 
query toolsql tooleasy sql editorsql toolsedit sqlquery toolssqlwritersql writersql query tool
...display a thumbnail and clicking the thumbnail will show a popup window with the full sized image...of this control is its BLOB 2 way data binding feature. Now, you can simply bind the...byte[] BlobData property of this control to your VarBinary or...any byte[] datatype of your DataSource and place this control in your DataBound Container...using this control (Setting Upload Mode=true).
 
blobupload controldownload controlsqliframe controlblob controlserver controlashx handleraspnetfile controlimage control
...interface. You can also export tiff page count data into excel and text files for your reference....-> Tiff Counter supports individual page counts. -> Show total page counts. -> Page count data export...
 
tif page countcounting tiff filestif countercount tiff filestiff countercount tiff pages

Freeware by max
75 x 825Kb downloads

...interpreter LUA. Loading files into base and extract data from base to file; show pictures, sound and...
 
mysqleditordatabases
Paessler Netflow Tester

Freeware by Paessler AG
59 x 680Kb downloads

...Testers are small programs that simply dump the data of all NetFlow packets that a computer receives...computer running NetFlow tester so that the UDP data packets with NetFlow data are sent to this...for each packet the computer receives. Each line shows the time, NetFlow version, number of flows and...v5 and v9). NetFlow5Tester only: Enable "Show Flow Data instead of packet data" to also show the...
 
firewallfreewaremrtggraphusagepacket sniffingmonitoringvolumetrafficpacket sniffernetflownetworkbandwidthroutersnmpciscoprtg
Interface Traffic Indicator

Freeware by Carsten Schmidt
80 x 807Kb downloads

...Inftraf is a tool that requests IN/OUT octet data (MIB2) from SNMP-capable network interfaces. You can use...start polling. Values in graph are calculated and shown as either bits or bytes per second or...Just select the appropriate graph. Error messages are shown in the statusbar at the bottom. Other functions...provided: - Show device information - Reset all values and graphs...
 
bitssecnicmiboutgoingand outtrafficbytessecutilizationsnmpmonitoringinterfaceincoming
Image Eye

Freeware by FMJ-Software
75 x 727Kb downloads

Free Vista Files award
...player. - It does include a simple slide show scripting language. - Translated to several languages. -...& caching of images in the background. - Data parallelism exploitation with SSE/SSE2/SSE3/SSE4 SIMD vector-instructions. - Task...resizing) using Catmull-Rom interpolation. - Extensive text meta data support. - Native x64 (64-bit) and x86 (32-bit)...
 
bmpcalshdrviewertifffasttgapsdpcxicofreegifpicturepngimageddsjpg jpegfreeware
Audio Identifier

Freeware by BitAttack
81 x 1583Kb downloads

...your audio collection with it and it will show you useful information, like average bitrate, used encoder...It has Unicode support, the capability of exporting data as HTML and much, much more. It supports...
 
file audio analyzeraudioidentifieraudio identifier
...seconds. You can also export PDF page count data into excel and text files for your reference....-> PDF counter supports individual page counts. -> Show total page counts. -> PDF page count data...
 
pdf countercount pdf pagecount pdf pages
AddInternet Domain Search

Freeware by AddInternet.com
107 x 35785Kb downloads

...looking for and click Go. The software will show you all domains and domain extensions available for...find out who is the domain owner including data such as company, name, address, email and more...Search box and click Go. The software will show you all available data for that domain and...
 
domainssearch whois databasesearch domain namessearch domainsdomain datadomains searchesdomain search softwaredomain extensionswhois searchdomain search freewarefind out domain owner
Emsa Save My Work

Freeware by EMSA SYSTEMS LTD
39 x 440Kb downloads

...Work is a quite simple but useful typed data recovery program. It works on a principle similar...is helpful because it saves all your typed data while you work. How many times you have...click on the systray icon at anytime to show the main window and see your typed data....the main text log box. Copy the typed data from this window inside your document, do a...
 
data recoverysave workkeystroketext editorkeyloggerdocuments
BeTrayed

Freeware by John Foster
31 x 239Kb downloads

...to launch and, optionally, the tooltip text to show and an alternative icon. If not specified, the...(with the default icon from Calc.exe), which would show a tooltip of `Calculator` In batch mode, the...
 
minimize traysystem traylaunchersend traynotification area
Halftone Search

Shareware by TrieTech
69 x 6611Kb downloads

Free Vista Files award
...The program can extract compressed files on-the-fly and show their contents. It also provides several ways to...know, Google Desktop uses "drivers" to collect searchable data from your local files. "Drivers" are plugins that...
 
windows searchhxswindows desktop searchmhtarchivesplugingoogle desktopchm
EndTask Free

Freeware by Osama Abdel-Karim
32 x 1200Kb downloads

...your internet connection speed since the windows have data that needs to be transmitted to you. But......design allows the user to easily hide or show a pop-up depending on whether it`s one they...
 
anti poppopup killerpop killerpop-upadwarestop popupspopup stopper
Emsa FlexInfo Pro

Freeware by EMSA SYSTEMS LTD
35 x 624Kb downloads

...a comprehensive system information and diagnstics utility. It shows system information data, advanced info, benchmark (CPU and...the benefists of modern OS in order to show extremely comprehensive system information. The CPU graph and...memory indicators show realtime info about these parameters, like memory allocation...
 
benchmarkdnsaddressdiagnoseutilitiessystemutilitydiagnosticstoolsnslookupinformationtesting
Emsa PC FlexInfo

Freeware by EMSA SYSTEMS LTD
46 x 353Kb downloads

...(IP and host lookup, Ping tool). It also shows realtime stats on items like CPU and memory...load. The system information data is presented as text so it can be...and win.ini files.The CPU graph and memory indicators show realtime info about these parameters, like memory allocation...
 
dnstestingutilityinformationnslookupdiagnosebenchmarkaddresssystemtoolsutilitiesdiagnostics
HDD Thermometer

Freeware by RSD Software
157 x 272Kb downloads

...the features needed to prevent overheating and possible data loss. HDD Thermometer use S.M.A.R.T. technology to get...actions when exceed Warning or Critical temperature: a) Show Notification b) Play Sound c) Execute Application d)...Shutdown / Hibernate * Show hard disks temperature indicators in SysTray; * Log...
 
overheatingthermometerdisktemperaturedrivehdd
Emsa DiskCheck

Freeware by EMSA SYSTEMS LTD
48 x 185Kb downloads

...DVD or hard drive; or even floppy) and show any read errors that may appear, but also...with drive performance but also with the way data is stored on it, which obviously impacts on...
 
dvdsurface testbenchmarkingscanhdddisk checking
...Editor that uses a synchronized table-tree-and-text display to show you both the hierarchical and the tabular nature...
 
xml editorjsonunicode

Freeware by WiredPlane.com
55 x 929Kb downloads

...The kernel of the program is easy-to-use tree-structured data holder. You can store any kind of data...activity on your workplace by holding any text data in one place 3) Reminder can start any...computer, send a net message to other users, show alert. Reminders can be shared among net users...
 
messagewinpopupnotespamtodolan messengerjunk emailreminder