1 2 3 4 5 6 7 8 9 ... 19 20 21 22 23 24 25 26 27 28

Sort by : ReleasedNameDownloadsAddedRatingRelevance
SecureCRT

Shareware by VanDyke Software Inc.
120 x 17100Kb downloads

Free Vista Files award
...SecureCRT for Windows, Mac, and Linux provides rock-solid terminal emulation, secure remote access, file transfer, and data tunneling with advanced session management and automation. Access an array of network...
 
replace telnetencryptionssh2secure remote administrationremote accessterminal emulationport forwardingsftpsecure shelltunnelingdata tunnelingssh clientssh1file transfer
Batch & Print Enterprise

Shareware by Traction Software
8 x 29918Kb downloads

...in document sequence of your choice, All associated shell printable documents are supported, e.g. PDF, MS Word,...
 
serverhtmlquarkbatchdocumentsenterprisetiffprintpdfjpgbmp
newObjects ActiveX Pack1 family

Freeware by newObjects
33 x 2590Kb downloads

...threads running scripts. 3) System and file information, shell tools 4) Multipurpose dictionary objects (universal collections) 5)...
 
sqlshortcutdatabasecomponentstoragejscriptfilethreadvbscriptcollectionlibraryrecordcryptographybinaryflataspstream
z/Scope Workbench Code Editor

Shareware by Cybele Software Inc.
9 x 11868Kb downloads

...z/Scope Workbench offers its users an unmatched range of benefits produced by the unique integration of accessing and editing tools in just one product. It includes a solid emulation...
 
jclssh15250 emulationiseriesmainframecobolibmssh2clistencryptionsecureterminal emulatorvt220 vt320 vt420htmlcode editorvt100rpgivterminal emulationtn5250asm370rexxas400unix filesdds
Jolix CD-DVD Burner

Freeware by Jolix Tools
13 x 2340Kb downloads

...for various features such as General, Advanced, Language, Shell Extensions. What Jolix CD-DVD Burner has to offer:...
 
burn cddvdcddvd burning solutionaudio burnercddvd recording programrecord cddvdcddvd recorderjolix cd-dvd burnerbackup solution
TurboFTP

Demo by TurboSoft, Inc
27 x 9886Kb downloads

Free Vista Files award
...with an upload wizard utility integrated with Windows Shell and a specialized log viewer program TurboLogViewer....
 
sslauto uploadresumefirewallcute ftpsecureautomaticstallclienttlsdirectory compareproxyfile transferpreserve file timeftp serversoftwarereconnectpassword encryptionftp programsupload wizardssh2sftp
...Many Ways Of Cooking Eggs by is an interesting guide on achieving variety in preparing meals with eggs.  It talks about various recipes including sauces, omelets, Plain Scrambled, Scrambled with...
 
eggscookingbreakfast
z/Scope SSH,VNC and RDP Client

Shareware by Cybele Software Inc.
16 x 10937Kb downloads

...z/Scope Express VT is a light-weight, fast and secure terminal emulator, featuring an integrated tabbed multisession emulation. It runs under Windows platforms. z/Scope provides full support of...
 
telenet emulationsshtelenet emulatorvt220 vt320 vt420vtxxx emulationssh2unix telnet clientvt100ssh1encryptionterminal emulationtelenet clientterminal emulatortelnet terminalsecure shellunix servervt100 emulation
Multi-Edit 2008 Lite for SAS

Demo by Multi Edit Software, Inc.
21 x 18369Kb downloads

Free Vista Files award
...level you get from the ISPF or Unix shell environment. Create and edit menus, tool bars, and...
 
highlightingasciisyntaxregexdevelopmentsearch and replaceeditorsspell checkcompilerebcdicperlezrtoolssasregexphexunixcodetextcomparespell checkerdelphiprogrammersexpressionprogramminghtmlautocorrectmacros
Montage

Shareware by SpaceTime Systems
9 x 6195Kb downloads

...Montage is a visual organizer and automation tool that enables you to use Windows more productively, saving time, making the most of screen space, and integrating diverse applications. It is...
 
multiplelayoutshortcutdistributepaperlessconfigurationwindowssavedropactivitydesktopproductivitypublishofficeorganizedragtoolmanagescreenintegratedisplayrestorelinkportableplacementarrangeexplorerreferenceshelllaunch
WinTar

Shareware by Miscosoftware
19 x 4028Kb downloads

...The WinTar application was designed to be a simple and cute 32-bit Windows version tarball archiver. A powerful tool which allows you to create, manage and extract most popular...
 
taztb2shargnu tarcabwindows tarball archiverbzip2paxtarzarchive typestgzustarcpiounix archivewintarlinux archivecompressiontbz2mtreeisogziptargztarbz2
HT TV Plus

Shareware by Honest Technology
63 x 57252Kb downloads

...honestech`s HT TV Plus 4.0 Gold offers an integrated suite of 7 MPEG video applications for digital TV experience on a PC - HT TVR 2.0, Internet Electronic...
 
mpegeditdigitalencodingvideotapesvcdtranslationanimationtranslateudfvhsauthoringmultimediawmvencodeconvertfilmdvdmpgudicamcorderdivxvtrmoviecinema
Hanso Burner

Freeware by HansoTools
32 x 2562Kb downloads

...top-right) includes General (features), Advanced (features), Language (features), Shell Extensions (features). Hanso Burner is released under GPL...
 
data burning softwarecddvd burning solutionhanso burnercddvd burnercddvd recording programburn cddvdcddvd recorderdata recording softwarecddvd backup solutionrecord cddvd
Artensoft Photo Editor

Shareware by Artensoft
15 x 15000Kb downloads

...photo adjustment and picture editing features in a shell that is plain, easy, and straightforward. Artensoft Photo...
 
photo editorslide showphoto viewerpicture viewerresize picturesbatch photo resizeresize photosbatch editorresize images
...Powerful launcher and scheduler that provides quick access to your favorite applications, folders, websites, and documents. Input new shortcuts by drag-n-drop, launch shortcuts using hotkeys, schedule shortcuts to...
 
runlauncherkeyfileshotkeyhotkeysinsertermanagershortcutwebsiteutilitykeystrokefavoriteitemstextstartquickfastprogramtoolgroupdesktopapplicationhot keydocumentfoldershell
...Designed for *all* Windows operating systems, Tweaki is your Swiss Army knife of utilities. Configure, secure and optimize Windows, MS Office and Internet Explorer. Add productivity enhancements like right click...
 
system2000securityinternetpowerdesktoptweakiexplorermanageconfigurejermarregistrywindowsshell
...files. abcAVI Tag Editor comes with Info Tips Shell Extension. It means when you place mouse cursor...
 
copyrightfourcc changercatalogtitlesearchdecoderauthoringmeta tagsvideo and audiocodecencodertags editordivx
EF Commander

Shareware by EFSoftware
37 x 8933Kb downloads

Free Vista Files award
...EF Commander is a powerful and multi-featured file manager witch a wide range of users, from beginners to professionals, will find easy to use. Here are some key features...
 
7zipftpstbzpacker7-zipgziplhashellcpiorartgztxzarcsfxtoolutilityefcwcommanderrpmexplorer replacementtarimgefsoftwarezip64bzipcabfile managernortonsqxarjbzip2iso9660zoo
Picture Viewer .EXE

Shareware by SoftTech InterCorp
53 x 2377Kb downloads

...It has never been easier to view images and pictures on your computer whether your images come from the internet, digital cameras, photo galleries or scanners. Create and run slideshow...
 
tifgifviewerplaylistgalleryslideshowimagepictureviewerexemanagejpgbmppresentationsphotocreatedisplaygraphicswallpaper
...Powerful launcher and scheduler that provides quick access to your favorite applications, folders, websites, and documents. Input new shortcuts by drag-n-drop, launch shortcuts using hotkeys, schedule shortcuts to...
 
startgrouprunhotkeyfavoritefilefasthot keyitemtextquickapplicationtoolshellutilitylaunchkeystrokefolderhotkeysinsertermanagerwebsitedesktoplaunchershortcutitemsdocumentprogramfiles