1 2 3 4 5 6 7 8 9 10

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
92 x 126464Kb downloads

Free Vista Files award
...RSS feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
GanttPV for Windows - Project Scheduling

Freeware by Brian C. Christensen
35 x 6483Kb downloads

...schedule performance, and out-of-pocket expenses. Plan multiple projects. Share resources. Prioritize follow up items across projects. Print...Write scripts in Python. Create task network diagrams. Share data via GanttPV Server. Information modeling and relational...
 
project managementearned valueganttbar chartgantt chartganntcritical pathscheduletask
Legacy Family Tree

Freeware by Millennia Corporation
38 x 48862Kb downloads

Free Vista Files award
...program that helps you track, organize, print, and share your family history. The program is free and...makes it easy to track research and other tasks that need to be done. Links to the...merge capabilities are second-to-none among genealogy programs. The IntelliShare feature makes it easy for groups of two...
 
ancestorlegaciesgenealogyfamilieslegacycensushistoryfamily treereunionmillenniaancestorsmormonpedigreeancestralgeneologyldspaffreedescendantsparentsrootsancestrysoftwaresourceschildren
Gigaget

Freeware by Giganology
213 x 2052Kb downloads

...validation and correction Import/export download list, easy to share with friends Multi file formats and browsers Support...
 
download tooldownload clientdownload managet
...hoc, cross-organizational teams to easily access, update and share team knowledge on their computers and within the...more securely and more effectively. Team members access shared workspaces locally on their computers, communicate with their...
 
task managementgroupwarepeer-to-peerp2pfreewarecollaboration softwareproject managementfile sharinginstant messagingsecure messagingteamworkvoipdocument management
GroupWare

Demo by Alt-N Technologies, Ltd.
10 x 1946Kb downloads

...as the mail server platform. Outlook users can share Calendar, Tasks, Contacts, Notes, and Journal folders without...the permissions of which folder(s) they wish to share with other users, WorldClient (MDaemon`s web-based email client)...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
QSearchFolders

Shareware by Quester
13 x 1017Kb downloads

...QSearchFolders creates search folders and manage existing search folders in all versions of MS Outlook and in each place in an Outlook tree. It makes the automatic scanning of Outlook...
 
share foldersoutlook shared filespersonal folderssharing pstoutlook folder managementshare outlookoutlook teamoutlook groupwareoutlook sharingoutlook search folderoutllook folder listsearch folders
AdRem iTools

Commercial by AdRem Software
38 x 18500Kb downloads

...from graphing capabilities in Ping or Traceroute tasks, share entered IP addresses/hostnames between utilities, and create desktop...
 
snmpdns lookupadrem itoolstelnetftpadministrative toolsscannerpingsubnetwork calculatornetwork toolstraceroute
MetaDataMiner Catalogue PRO

Shareware by Soft Experience
15 x 2549Kb downloads

...file information and hypertext links : you can share documentation catalog in a project team and save...forensic purposes. XML metadata export helps on migration tasks in particular for digital libraries management projects....
 
batchcatalogminerconversionpropertiesfileproductivitymetadatalist directoriesexportutilityiptcarchivistgeneratorproject managementcmsxsladobehtmlofficerdfextractionxmladd-inscsvxmpdocumentationcontent
ASP.NET Ria Esssential Pack

Freeware by Radar-Soft, L.L.C.
3 x 2054Kb downloads

...applications, the RIA`s client side takes the lion`s share of computing tasks, and so frees the server...
 
essential packweb gridviewsilverlight chartaspnet gridria chartsilverlight gridviewria gridviewaspnet chartweb chart online
DzSoft Slide Show

Shareware by DzSoft Ltd
25 x 2056Kb downloads

...for you a distributable self-running slide show to share with your friends. DzSoft Slide Show is not...
 
slideshowmultimediadzsoftscreensaverphotoshare
SecureFX

Shareware by VanDyke Software Inc.
19 x 11878Kb downloads

Free Vista Files award
...of SecureFX and SecureCRT, which allows you to share sessions and settings without reentering passwords. Or create...
 
secure ftpsshsftpssh2van dykesecurefxtransfersecure shellwindowsfile transfer
Macro Toolworks, Professional Edition

Shareware by Pitrinec Software
19 x 15411Kb downloads

Free Vista Files award
...disable macro editing/executing without a valid password. - Shared macros allows user groups to share the same...
 
keyboardfasttoolbarenhancementrecordertypingdebuggerautomateschedulermousescriptmacroautomationclipboard
MAPILab Share`n`Sync

Shareware by MAPILab Ltd.
12 x 3009Kb downloads

Free Vista Files award
...MAPILab Share`n`Sync is designed to solve two tasks - synchronizing Outlook folders on several computers and...organizing shared access to Microsoft Outlook folders for small companies....Server. So if you want to synchronize a shared folder on Microsoft Exchange Server with an ordinary...
 
sync pstmicrosoft outlookoutlook add-inoutlook shared accessoutlook synchronizationpublic folders
...Active Directory management tools. Administrators can perform various tasks in the internal structure of the AD as...Lepide Active Directory Manager has got excellent Remote Shares functionality. Administrator can therefore easily open and access...the shell properties of Remote computer’s shares and further manage user rights on that share....
 
active directory domainactive directory tutorialactive directory serveractive directory management
Chroniker for Availability Monitoring

Demo by NRG Global
12 x 24377Kb downloads

...pull up reports for any date Email reports: share with managers or colleagues Export report data to...
 
log managementcitrix monitoring softwarenetwork monitoringavailability monitoringsystem monitoringdatabase monitoringwebserver monitoringserver uptimebusiness dashboardsapplication response time
NetworkGazer

Commercial by DoubleUp Software
13 x 2073Kb downloads

...glimpse of your network current configuration. Lookup network shares on a computer and find out who has...all login profiles per machine. View all schedule tasks (not only AT assigned jobs) on remote machines....
 
wake-on-lanschedule tasksnetwork adapterprocessornetwork shareswakeonlanopen portsnetwork documentingevent logsinternet historymac addressshutdownrebootdisk drives
UIFriend

Shareware by Intrepix LLC
14 x 1905Kb downloads

...your monitor to your mood, or to the tasks at hand. The program also remembers the location...for multiple users that makes it easy to share a computer with colleagues or family. Each user...
 
screensavertransparentmuteicon layoutdisplay settingsdouble bufferquick resolution changingquickresscreen saverdesktop
Sciral Consistency for Windows

Shareware by Sciral
8 x 796Kb downloads

Free Vista Files award
...Calendars keep track of tasks where you need to coordinate with others by...times and intervals. To-do lists keep track of tasks that you will do once, and that you...are optimal. You`re probably trying to wedge these tasks into those tools, but they really call for...tool: Sciral Consistency. The kinds of activities or tasks you use Sciral Consistency for share a number...
 
schedulingcalendarprioritieslistplannervaluespersonalorganizeplanningactivityinformationlistsactivitiesdeadlinesorganizerpimprioritymanagertodorepeatmanagementrepeatingschedulertasksgoals
...platforms to manage email, contacts, groups, appointments and tasks using a standard web browser. Through a regular...features allow multiple users inside the domain to share contacts and appointments. Received messages can be clearly...
 
calendarisapigroupwarewebmailsmtppop3email