1 2 3 4 5 6 7 8 9

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...RSS feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online document sharing into a...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
GanttPV for Windows - Project Scheduling

Freeware by Brian C. Christensen
48 x 6483Kb downloads

...schedule performance, and out-of-pocket expenses. Plan multiple projects. Share resources. Prioritize follow up items across projects. Print...Write scripts in Python. Create task network diagrams. Share data via GanttPV Server. Information modeling and relational...
 
project managementearned valueganttbar chartgantt chartganntcritical pathscheduletask
Legacy Family Tree

Freeware by Millennia Corporation
51 x 69666Kb downloads

Free Vista Files award
...program that helps you track, organize, print, and share your family history. The program is free and...makes it easy to track research and other tasks that need to be done. Links to the...merge capabilities are second-to-none among genealogy programs. The IntelliShare feature makes it easy for groups of two...
 
familiesancestryancestorslegaciesmormonfreegeneologyldscensusfamily treerootsdescendantsgenealogypedigreepafancestralsourceschildrenmillenniareunionparentshistorylegacysoftware
Gigaget

Freeware by Giganology
219 x 2052Kb downloads

...validation and correction Import/export download list, easy to share with friends Multi file formats and browsers Support...
 
download tooldownload clientdownload managet
Collanos Workplace Windows

Freeware by Collanos Software Inc.
15 x 58649Kb downloads

...hoc, cross-organizational teams to easily access, update and share team knowledge on their computers and within the...more securely and more effectively. Team members access shared workspaces locally on their computers, communicate with their...
 
task managementgroupwarepeer-to-peerp2pfreewarecollaboration softwareproject managementfile sharinginstant messagingsecure messagingteamworkvoipdocument management
GroupWare

Demo by Alt-N Technologies, Ltd.
16 x 1946Kb downloads

...as the mail server platform. Outlook users can share Calendar, Tasks, Contacts, Notes, and Journal folders without...the permissions of which folder(s) they wish to share with other users, WorldClient (MDaemon`s web-based email client)...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
LiveProject Free Project Viewer

Freeware by KaDonk, Inc.
70 x 29656Kb downloads

...viewer that opens Microsoft Project files, shows you tasks lists, Gantt charts, calendar views and everything a...a step further with version 5 and includes SharePoint integration. View your own SharePoint databases and open...can enjoy the view of your own project, share it with others, or easily open client project...- Upgradeble to include printing, dashboards, exporting and SharePoint support. - This free version has some limitations...
 
liveprojectmppproject collaborationproject serverproject planproject viewerproject managementoffice project serversharepointmicrosoft projectproject schedulekadonk
QSearchFolders

Shareware by Quester
19 x 1017Kb downloads

...QSearchFolders creates search folders and manage existing search folders in all versions of MS Outlook and in each place in an Outlook tree. It makes the automatic scanning of Outlook...
 
share foldersoutlook shared filespersonal folderssharing pstoutlook folder managementshare outlookoutlook teamoutlook groupwareoutlook sharingoutlook search folderoutllook folder listsearch folders
AdRem iTools

Commercial by AdRem Software
45 x 18500Kb downloads

...from graphing capabilities in Ping or Traceroute tasks, share entered IP addresses/hostnames between utilities, and create desktop...
 
snmpdns lookupadrem itoolstelnetftpadministrative toolsscannerpingsubnetwork calculatornetwork toolstraceroute
MetaDataMiner Catalogue PRO

Shareware by Soft Experience
21 x 2549Kb downloads

...file information and hypertext links : you can share documentation catalog in a project team and save...forensic purposes. XML metadata export helps on migration tasks in particular for digital libraries management projects....
 
batchcatalogminerconversionpropertiesfileproductivitymetadatalist directoriesexportutilityiptcarchivistgeneratorproject managementcmsxsladobehtmlofficerdfextractionxmladd-inscsvxmpdocumentationcontent
ASP.NET Ria Esssential Pack

Freeware by Radar-Soft, L.L.C.
7 x 2054Kb downloads

...applications, the RIA`s client side takes the lion`s share of computing tasks, and so frees the server...
 
essential packweb gridviewsilverlight chartaspnet gridria chartsilverlight gridviewria gridviewaspnet chartweb chart online
DzSoft Slide Show

Shareware by DzSoft Ltd
41 x 2056Kb downloads

...for you a distributable self-running slide show to share with your friends. DzSoft Slide Show is not...
 
slideshowmultimediadzsoftscreensaverphotoshare
Macro Toolworks, Professional Edition

Shareware by Pitrinec Software
29 x 15411Kb downloads

Free Vista Files award
...disable macro editing/executing without a valid password. - Shared macros allows user groups to share the same...
 
schedule taskswindows schedulermacrosmacro schedulerwindows macromouse macrowindows macrosschedule macrosmacro softwaremacro recorderwindows automationkeyboard macrosautomate windows
MAPILab Share`n`Sync

Shareware by MAPILab Ltd.
18 x 3009Kb downloads

Free Vista Files award
...MAPILab Share`n`Sync is designed to solve two tasks - synchronizing Outlook folders on several computers and...organizing shared access to Microsoft Outlook folders for small companies....Server. So if you want to synchronize a shared folder on Microsoft Exchange Server with an ordinary...
 
sync pstmicrosoft outlookoutlook add-inoutlook shared accessoutlook synchronizationpublic folders
Chroniker for Availability Monitoring

Demo by NRG Global
17 x 24377Kb downloads

...pull up reports for any date Email reports: share with managers or colleagues Export report data to...
 
log managementcitrix monitoring softwarenetwork monitoringavailability monitoringsystem monitoringdatabase monitoringwebserver monitoringserver uptimebusiness dashboardsapplication response time
NetworkGazer

Commercial by DoubleUp Software
17 x 2073Kb downloads

...glimpse of your network current configuration. Lookup network shares on a computer and find out who has...all login profiles per machine. View all schedule tasks (not only AT assigned jobs) on remote machines....
 
wake-on-lanschedule tasksnetwork adapterprocessornetwork shareswakeonlanopen portsnetwork documentingevent logsinternet historymac addressshutdownrebootdisk drives
UIFriend

Shareware by Intrepix LLC
21 x 1905Kb downloads

...your monitor to your mood, or to the tasks at hand. The program also remembers the location...for multiple users that makes it easy to share a computer with colleagues or family. Each user...
 
screensavertransparentmuteicon layoutdisplay settingsdouble bufferquick resolution changingquickresscreen saverdesktop
Sciral Consistency for Windows

Shareware by Sciral
18 x 796Kb downloads

Free Vista Files award
...Calendars keep track of tasks where you need to coordinate with others by...times and intervals. To-do lists keep track of tasks that you will do once, and that you...are optimal. You`re probably trying to wedge these tasks into those tools, but they really call for...tool: Sciral Consistency. The kinds of activities or tasks you use Sciral Consistency for share a number...
 
schedulingcalendarprioritieslistplannervaluespersonalorganizeplanningactivityinformationlistsactivitiesdeadlinesorganizerpimprioritymanagertodorepeatmanagementrepeatingschedulertasksgoals
...platforms to manage email, contacts, groups, appointments and tasks using a standard web browser. Through a regular...features allow multiple users inside the domain to share contacts and appointments. Received messages can be clearly...
 
calendarisapigroupwarewebmailsmtppop3email
Auto FTP Manager

Shareware by DeskShare
33 x 9549Kb downloads

Free Vista Files award
...up servers. With Auto FTP Manager file transfer tasks take less time and less effort. Schedule file...that everyone has the most current documents. Easily share or back up critical information. The familiar drag-and-drop...
 
script ftpautomate ftpftp sslftpsfile transfersynchronizeauto ftp managerqueuefiltercommand linesynchronize directoriessecure ftpcommand line ftpschedule transfer