1 2 3

Sort by : ReleasedNameDownloadsAddedRatingRelevance
Software602 Groupware Server

Shareware by Software602, Inc.
121 x 126464Kb downloads

Free Vista Files award
...web client integrates e-mail, RSS feeds, public folders, contacts (vCard), tasks, reminders, shared calendar (iCal/iCalendar), and online...functionality from anywhere using a standard web browser.The Outlook Connector provides real-time, two-way synchronization of mail, contacts,...tasks, calendar events, notes and journal items between Outlook (2002/2003/2007) and the Groupware server. Any standard POP3...
 
dnsbladdress bookexchangegroupwaresslpop3bayesianimapspamvcardtaskservercollaborationsharedwebdavicalendarsmtpinternetcontactssmimemessagingblacklistemailfaxe-mailarchiveftpsdns-blldapoutlook
OsaSync Lite

Freeware by Vaita
17 x 2963Kb downloads

...With OsaSync Lite you can share and/or synchronize Microsoft Outlook contacts on your local...Use OsaSync Lite when you want to: a} Share some common contacts in your contacts folder with...your family members. b) Synchronize your Outlook folders on your laptop with your desktop. c)...with others. Save your customers in a COMMON CONTACTS FOLDER Share you Outlook contacts with one, two...your network.
 
cell phonesynchronizationsynchronizeoutlookshareemailcontactspdacollaboratesharingnet folderscollaborationpalm
GroupWare

Demo by Alt-N Technologies, Ltd.
16 x 1946Kb downloads

...MDaemon GroupWare unlocks the collaborative functions of Microsoft Outlook using MDaemon as the mail server platform. Outlook...users can share Calendar, Tasks, Contacts, Notes, and Journal folders without...the permissions of which folder(s) they wish to share with other users, WorldClient (MDaemon`s web-based email client)...will allow you to see items in your Outlook calendar from anywhere, and GroupWare licensing is independent...
 
mdaemonshare foldersshare tasksshare contactshttpldapimapsmtpgroupwareweb mailpop3email serverexchange alternativeshare calendare-mail
QSearchFolders

Shareware by Quester
19 x 1017Kb downloads

...existing search folders in all versions of MS Outlook and in each place in an Outlook tree....It makes the automatic scanning of Outlook folder such as email and contacts, tasks, calendars...way to gather email messages and other Microsoft Outlook items into a folder based on your search...their locations. One of the new features of Outlook 2003 are search folders, once created the for...
 
share foldersoutlook shared filespersonal folderssharing pstoutlook folder managementshare outlookoutlook teamoutlook groupwareoutlook sharingoutlook search folderoutllook folder listsearch folders
MAPILab Share`n`Sync

Shareware by MAPILab Ltd.
18 x 3009Kb downloads

Free Vista Files award
...is designed to solve two tasks - synchronizing Outlook folders on several computers and organizing shared access...to Microsoft Outlook folders for small companies. The product supports all...types of Microsoft Outlook folders and items - email messages, contacts, notes,...folders and items that don`t belong to Microsoft Outlook and which are attached with the help of...Server.
 
sync pstmicrosoft outlookoutlook add-inoutlook shared accessoutlook synchronizationpublic folders
...personal address book and appointment calendar. Existing MS Outlook or Outlook Express contacts can be imported easily...features allow multiple users inside the domain to share contacts and appointments. Received messages can be clearly...
 
calendarisapigroupwarewebmailsmtppop3email
WebAsyst Address Book

Shareware by WebAsyst, LLC
18 x 2441Kb downloads

...you to organize contact entries into folders and share access with your team. Enhanced navigation and usability....contain as many entries and subfolders as necessary. Contacts can be displayed in Grid or List format....to new location. You can also copy/move multiple contacts in a batch mode to any accessible folder....Results list. Import/Export your address book from/to MS Outlook Express, The Bat or custom .CSV file. When...
 
web based contact managementonline address book softwareonline contact managementcontact management softwareweb based address book
Active Desktop Calendar

Shareware by XemiComputers Ltd.
99 x 5627Kb downloads

Free Vista Files award
...fully customizable calendar with notes, tasks, alarms and contacts provides seamless integration and interactivity with the desktop...organize your data in color coded layers and share them with other people on a local area...network. The program can integrate with Outlook to show its appointments and tasks on the...all your contacts, personal and business alike. Importing contacts from different sources is possible. Google and other...
 
recurring appointmentswallpaperpersonal information managerorganizertasksschedulerprintdata sharingxemicomputersalarmsactive desktop calendaraddress booknotespimcontactsrecurrencelanicons
ShareCalendar for Outlook

Shareware by 4Team Corporation
170 x 8153Kb downloads

Free Vista Files award
...Share and synchronize Outlook calendar on multiple PCs without Exchange server. ShareCalendar...is a Microsoft Outlook add-in for sharing and synchronizing Outlook calendar folders....sync meetings in a few clicks. Synchronize and share outlook calendar items automatically or manually. Share different...of your family or coworkers. Synchronize your PCs Outlook calendar information between your desktop, laptop, netbook and...
 
appointmentsync outlook calendarshare calendarcalendar itemsynchronize outlook calendarmeetingoutlook calendar syncsync calendarshare outlook calendarsync calendar outlook
ShareO for Outlook

Shareware by 4Team Corporation
17 x 8106Kb downloads

Free Vista Files award
...Synchronize and share Outlook folders on multiple PCs without a server. Microsoft...Outlook add-in for synchronizing and sharing Outlook folders, sharing PST, sharing e-mail, sharing calendar, tasks,...notes and journal items without Exchange server. Share Microsoft Outlook Public or Personal folders, Windows documents...with your collegues, family and friends easily.
 
share contactssync outlooksharing outlookshare outlook contactssharing emailsharing pstoutlook syncshare outlook calendarsharing outlook calendarshare calendaroutlook sharingoutlook sharesynchronize outlook
ShareContacts for Outlook

Shareware by 4Team Corporation
24 x 8170Kb downloads

Free Vista Files award
...Share and sync Outlook contacts on multiple PCs without Exchange server. ShareContacts is...a Microsoft Outlook add-in for synchronizing and sharing Outlook contacts. Sync contacts folders, sync address book, sync...distribution lists in a few clicks. Synchronize and share Outlook contacts automatically or manually. Share different contact folders with...coworkers, teammates, friends or family.
 
outlookcontactssync outlook contactsshare contactssharing outlook contactssync address bookoutlook sync contactsoutlook sharing contactscontacts outlooksynchronize outlook contacts
Outlook TeamContacts

Shareware by OpusFlow
15 x 422851Kb downloads

...To get a good overview of your co-worker contacts in one global address list integrated with Outlook...is a challange. TeamContacts is an easy to install Outlook add-on, which...solves that problem effectively and flexibly. Share your Outlook Contacts! - No Exchange Server required; - Filter...the address cards you want to share with categories; - PDA is supported; - Uses...a shared database, no email connectivity required...
 
contactsteamoutlookglobal address listgroupwareadd-ondatabase
OpusFlow CRM for Outlook

Demo by OpusFlow
21 x 9765Kb downloads

...OpusFlow CRM takes the Outlook contact card as the starting point for linking...tracking of all (even remote) related communication. The Outlook contact card you used to know has been...send personalized documents (letters, faxes, e-mails) from the Outlook address card. * track your appointments, tasks and...or emails you and your team receive. * share all customer information in your workgroup environment. *...Activities. * work off-line (PC, laptop, PDA).
 
contactrelationalgroupwareintegrationcrm outlook solutioncrm outlook serviceserverexchangemanagement
4Team for Outlook

Shareware by 4Team Corporation
18 x 7807Kb downloads

...Manage your teams and projects in Microsoft Outlook with this easy-to-use workgroup utility without or with...company`s intranet, your team members can create and share their multiple projects` workspaces including a calendar, contacts,...times and organize meetings, discussions, and teamwork on shared documents, and control and centralize members` activities. You...remote companies and groups or just for sharing Outlook data for personal use.
 
workgroupforumcalendarcontroldiscussionsadd-ondocumentsfilesnetfoldercontactemailmanagementadministrationtasksinformationcollaborationoutlookteamintranetnewsnotificationsexchangelinksprojectwebsharepointtools
vCard Wizard

Freeware by 4Team Corporation
32 x 8640Kb downloads

...up your Gmail, Android, iCloud, iPhone/iPad and Microsoft Outlook contacts to the destination of your choice. It...vCard Wizard you can export just several selected contacts or your whole contacts folder or selected folders...containing unlimited number of contacts. Transfer contacts from multiple sources, such as Gmail Contacts, Google...Contacts and iCloud Contacts, Microsoft Outlook Contacts and vCard or .
 
vcf convertertransfer contactsimport gmailvcardconvert vcfexport contactsvcf importvcard converterexport vcardexport from iphoneiphone transfer from androidimport vcardvcard outlookexport androidoutlook vcardimport contacts
OutShare for Outlook

Shareware by 4Team Corporation
27 x 10767Kb downloads

...(OutShare Service) for synchronizing and sharing your Microsoft Outlook data with Outlook on your other PC or...other users` PCs. OutShare offers a variety of features, but the basic...process is simple: select Outlook folders you want to sync or share on...your PCs and synchronize them with (upload to) OutShare Service; install Outshare on your other PC, log...in to your OutShare Service account from that PC and synchronize your.
 
sync outlookshare calendarsynchronize outlookshare outlooksynchronizationaddinspluginshare contactsworkgroupsharing
DataHouse

Shareware by DataHouseSoftware
28 x 2370Kb downloads

...sites for one company. Changes that affect several contacts are made only once not for each person....
 
sales managermrpmicrosoft accessbusiness softwaresales quote databasepurchase orderscrmforecastingbusiness reports
FTrack CRM

Shareware by EPsoft,S.L.
36 x 16666Kb downloads

...and balances. Also can be integrated with MS Outlook to share your contacts, documents, mails.... FTrack databases...on a Microsoft Access database and can be shared on a server. Includes: ->Products & Parts Management,...
 
help desksalesmailingcrmcall centermarketing
...PoliteMail turns Microsoft Office Outlook into an email marketing machine. Create, send &...forwards your email, all without ever leaving your Outlook inbox. It`s easy to learn and simple to...within your company using PoliteMail, you can easily share mailing lists, contacts, email templates and response reports...
 
email marketing softwareemail templatesopen trackingemail trackingoutlook add-on softwarelist managementemail campaignsmailing listmail mergeemail newsletteremail lists
ProjectTrack Personal Edition

Shareware by iLore
25 x 11101Kb downloads

Free Vista Files award
...what needs to get done. * Create and share REPORTS in your favorite format (PDF(r), MS Word(r),...to find the perfect word. * Synchronize your contacts with Outlook and email them directly from ProjectTrack....INTERFACE. ProjectTrack allows you to record, maintain and share all your project information from a single location....single-user application. If you want your team to share information in a multi-user environment, try the Collaborative...
 
taskprogramgantttrackingjournalmanagementspreadsheetoutlookriskcalendarclientcustomerprojectemailplanningissueinitiativeteamactionmilestonecontactmanagerexcelportfoliodocumentresolution